Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014008 pacid=23170042 polypeptide=Lus10014008 locus=Lus10014008.g ID=Lus10014008.BGIv1.0 annot-version=v1.0 ATGGTGGATCCAACCAAAAAAGGAAGAACAAGGGATTTTAATTTGTCTGTACGTTTCTGTAGAGGGTCTTTTACTCTTCGCTACTGTGTGCTTCCTACTT ACTATGTTGGTCTTCTAACTGCTGACCTGCTTTGGATGGTGAGAGGCCAAGACTGA
AA sequence Show only first row Show all	>Lus10014008 pacid=23170042 polypeptide=Lus10014008 locus=Lus10014008.g ID=Lus10014008.BGIv1.0 annot-version=v1.0 MVDPTKKGRTRDFNLSVRFCRGSFTLRYCVLPTYYVGLLTADLLWMVRGQD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014008 [exp]	0	1
					Lus10007554 [exp]	2.4	0.9279
AT4G14615			unknown protein		Lus10021896 [exp]	4.9	0.7973
					Lus10029087 [exp]	4.9	0.8857
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016495 [exp]	5.9	0.8778
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008534 [exp]	6.0	0.9107
AT1G01120		KCS1	3-ketoacyl-CoA synthase 1 (.1)		Lus10002691 [exp]	6.6	0.8849
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10024218 [exp]	7.7	0.8454
AT3G57030			Calcium-dependent phosphotries...		Lus10019148 [exp]	8.1	0.8833
AT3G54200			Late embryogenesis abundant (L...		Lus10003238 [exp]	8.5	0.8795
					Lus10020978 [exp]	12.4	0.8689

Compare expression of checked genes

Lus10014008 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.