Lus10014009 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77170 73 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13880 73 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G68930 69 / 3e-14 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G56550 68 / 4e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G04840 67 / 7e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G08070 67 / 7e-14 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18750 67 / 8e-14 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G15930 67 / 8e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18840 67 / 1e-13 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G04370 66 / 3e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004114 167 / 3e-54 AT3G13880 96 / 5e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019213 165 / 6e-49 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10004303 148 / 2e-45 AT2G21090 146 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10003383 147 / 2e-45 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10012796 66 / 3e-13 AT2G36980 516 / 1e-178 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022890 65 / 8e-13 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031661 65 / 9e-13 AT2G29760 427 / 3e-141 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029884 64 / 1e-12 AT1G77170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040680 64 / 2e-12 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G064301 71 / 1e-16 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.003G041650 73 / 3e-16 AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.012G108000 73 / 9e-16 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.018G145514 72 / 1e-15 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.006G244500 71 / 6e-15 AT3G15130 891 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G031600 71 / 7e-15 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G147873 67 / 7e-15 AT2G34400 168 / 5e-50 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.006G164100 70 / 8e-15 AT1G77170 553 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G121400 70 / 9e-15 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G068900 70 / 9e-15 AT3G20730 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10014009 pacid=23170073 polypeptide=Lus10014009 locus=Lus10014009.g ID=Lus10014009.BGIv1.0 annot-version=v1.0
ATGCCTGAACGAAATCTCGTCAGCTACAACTCAATGATTTCGGGGCTTTCTCGTGGTGGGTGTTACACGGAGGCGTTGGGTATGTTCATGAGGTTGCAGG
AAGATTGTGTTGGTGGGTTTTGTTTGGATGAGTTTACTGTTGCGAGTGTGGTGAGTTGTTGTGCGAGCTTTCGTGGATTGGGACTGGTTCGTCAGCTGCA
TGGTGTGGGGTTAGTTCTTGGGCATTTGGTGTTGCTAAATTCCTTGATTGATGCCTATGGGAAATGTGGAGAATCCGATTTTAGTCTCGGTGTGTTTTGC
TGGATGAACGAAAGGGATGTTGTTTCATGGACATCAATAGTGGCTGCTTATACTCTCGATCATCCTAACTGGATGAAGCTATTGGAATTTTCAAACAGTG
CCATATGGGAGCACTGTTGCTTGGACTAG
AA sequence
>Lus10014009 pacid=23170073 polypeptide=Lus10014009 locus=Lus10014009.g ID=Lus10014009.BGIv1.0 annot-version=v1.0
MPERNLVSYNSMISGLSRGGCYTEALGMFMRLQEDCVGGFCLDEFTVASVVSCCASFRGLGLVRQLHGVGLVLGHLVLLNSLIDAYGKCGESDFSLGVFC
WMNERDVVSWTSIVAAYTLDHPNWMKLLEFSNSAIWEHCCLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13880 Tetratricopeptide repeat (TPR)... Lus10014009 0 1
AT3G05710 ATSYP43, SYP43 syntaxin of plants 43 (.1.2) Lus10020683 7.1 0.7763
AT1G72510 Protein of unknown function (D... Lus10037683 12.2 0.8024
AT2G42940 AT-hook Predicted AT-hook DNA-binding ... Lus10031458 13.4 0.7934
AT2G45990 unknown protein Lus10036369 16.8 0.8034
AT1G53710 Calcineurin-like metallo-phosp... Lus10042936 21.6 0.7781
AT5G04980 DNAse I-like superfamily prote... Lus10008934 24.4 0.7761
AT1G61780 postsynaptic protein-related (... Lus10002066 26.2 0.7983
AT4G21192 Cytochrome c oxidase biogenesi... Lus10019246 30.6 0.7825
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10006383 34.9 0.7868
AT4G00290 Mechanosensitive ion channel p... Lus10005121 35.0 0.7719

Lus10014009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.