Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39420 51 / 1e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005786 [exp] 169 / 3e-50 AT4G39420 3258 / 0.0 unknown protein Lus10006814 [exp] 132 / 3e-37 AT4G39420 522 / 3e-163 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G086100 [exp] 83 / 4e-20 AT4G39420 3493 / 0.0 unknown protein Potri.007G078650 [exp] 70 / 2e-15 AT4G39420 3458 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014010 pacid=23170026 polypeptide=Lus10014010 locus=Lus10014010.g ID=Lus10014010.BGIv1.0 annot-version=v1.0 ATGACCAGATTACTTTTTCTTCCATCGGTTCACCCAGAGGATGTAAAAAATGAAGTGGATAACTCTCGAAGGCTCTATAATATGGGCCATTTTCTGGAGA TTGTCCGGAATCTTCAATATCGACTTGGTGCTATGTCAAAACAGATTGGACAGGGATCGGTGGATGGTAGGGATGCATTAAGTTTGGCAGAAGTCAATGC ATGTCCAGATGAACCCCACCTTCCTCTTATTTTACCAAATGCTGCATCATTGGAAACGTTAAACCAGCAGTGA
AA sequence Show only first row Show all	>Lus10014010 pacid=23170026 polypeptide=Lus10014010 locus=Lus10014010.g ID=Lus10014010.BGIv1.0 annot-version=v1.0 MTRLLFLPSVHPEDVKNEVDNSRRLYNMGHFLEIVRNLQYRLGAMSKQIGQGSVDGRDALSLAEVNACPDEPHLPLILPNAASLETLNQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39420			unknown protein		Lus10014010 [exp]	0	1
					Lus10036790 [exp]	4.9	0.8657
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10002603 [exp]	5.3	0.8743
AT2G15900			Phox-associated domain;Phox-li...		Lus10012043 [exp]	18.9	0.8563
AT5G04360		ATPU1 ,ATLDA	PULLULANASE 1, limit dextrinas...		Lus10037943 [exp]	24.9	0.8138
					Lus10022149 [exp]	25.8	0.7564
					Lus10042801 [exp]	26.3	0.8062
AT4G31570			unknown protein		Lus10026934 [exp]	29.1	0.8371
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10004179 [exp]	29.7	0.7950
AT5G58510			unknown protein		Lus10031851 [exp]	32.4	0.7582
AT2G46560			transducin family protein / WD...		Lus10005975 [exp]	32.9	0.8475

Compare expression of checked genes

Lus10014010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.