Lus10014026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56570 257 / 1e-82 PGN PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G56310 194 / 5e-59 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16835 194 / 6e-58 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 194 / 4e-57 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 188 / 4e-55 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G57430 188 / 7e-55 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 185 / 3e-54 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49142 184 / 3e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 183 / 5e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 185 / 7e-54 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019891 461 / 5e-162 AT1G56570 666 / 0.0 PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010998 192 / 4e-57 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014211 190 / 1e-56 AT3G11460 791 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022702 185 / 2e-55 AT3G11460 641 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000213 187 / 3e-55 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013540 186 / 2e-54 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016425 186 / 3e-54 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10000597 179 / 3e-54 AT4G16835 545 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001220 185 / 6e-54 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G006700 304 / 1e-100 AT1G56570 732 / 0.0 PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G010900 256 / 2e-82 AT1G56570 666 / 0.0 PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G019900 192 / 6e-57 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 192 / 2e-56 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G021700 189 / 4e-56 AT3G47840 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G223900 186 / 5e-56 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G082200 186 / 6e-56 AT2G37320 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G051300 186 / 2e-55 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G184800 189 / 3e-55 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G047600 189 / 3e-55 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10014026 pacid=23156858 polypeptide=Lus10014026 locus=Lus10014026.g ID=Lus10014026.BGIv1.0 annot-version=v1.0
ATGATGATTGGATATGGGGCTCATGGATATGGTATAGAGGCTGTAGCGCTGTTTGAGGAGATGGTGAGGTCAGATGTCAGGCCTGATCAGATTGTGTTTA
TGGCGGTTTTGAGTTCTTGTAGTCATGCTGGACTAGTCGACCAGGGCCTGAGGTATTTCAATACTATGATTGGTCACTACAAAATTAGGCCAAATCAGGA
AATTTATGGGTGTGTTGTGGATTTGTTGGGCAGAGCTGGGAGAGTTGAGGAGGCCTATCAGCTGATACACAGCATGCCATTTAAAGCTGACGAATCTGTT
TGGGGTGCGCTCCTTAGCGCCTGTAAAACCCATAACCTTCTAGATTTGGGTAAATTAGCTGCCTTGAGGGTGTTGGATTTGCAGCCAGATATGGTCAGTG
CTTATGTCATGCTGTCAAATATTTATGCAGCCGAAGGTAAATGGGACGAGTTTGCGAGGACAAGGAGATTGATGAAGGAAATTGTGAGCAAGAAGGTTTC
GGGGAAGAGTTGGATTGAAGTAAGAAACGAAGTATACAGTTTTGTCGTGGATGATACAGTTGGCATTCATATGGAGTTGGCACATCGAACTCTAGGTCTG
TTATGGCAGCACATGAAAGAAAAAGATAATATGGATGAAGACGACTGCTTAATAGATGCCATTGCAAATGGGGCTTGA
AA sequence
>Lus10014026 pacid=23156858 polypeptide=Lus10014026 locus=Lus10014026.g ID=Lus10014026.BGIv1.0 annot-version=v1.0
MMIGYGAHGYGIEAVALFEEMVRSDVRPDQIVFMAVLSSCSHAGLVDQGLRYFNTMIGHYKIRPNQEIYGCVVDLLGRAGRVEEAYQLIHSMPFKADESV
WGALLSACKTHNLLDLGKLAALRVLDLQPDMVSAYVMLSNIYAAEGKWDEFARTRRLMKEIVSKKVSGKSWIEVRNEVYSFVVDDTVGIHMELAHRTLGL
LWQHMKEKDNMDEDDCLIDAIANGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56570 PGN PENTATRICOPEPTIDE REPEAT PROTE... Lus10014026 0 1
AT4G13650 Pentatricopeptide repeat (PPR)... Lus10040997 3.5 0.7822
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10038741 6.2 0.7735
AT3G49740 Tetratricopeptide repeat (TPR)... Lus10019278 8.2 0.7557
AT1G77170 Tetratricopeptide repeat (TPR)... Lus10029884 12.5 0.6711
AT2G03880 REME1 required for efficiency of mit... Lus10022974 20.4 0.6988
AT2G01130 DEA(D/H)-box RNA helicase fami... Lus10007938 22.8 0.7528
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10000073 22.8 0.7598
AT4G20090 EMB1025 embryo defective 1025, Pentatr... Lus10036238 27.7 0.6872
AT3G18580 Nucleic acid-binding, OB-fold-... Lus10038946 28.6 0.6335
AT3G06950 Pseudouridine synthase family ... Lus10039480 31.9 0.7097

Lus10014026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.