Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05880 64 / 1e-15 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 62 / 6e-15 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT2G38905 59 / 1e-13 Low temperature and salt responsive protein family (.1) AT1G57550 50 / 2e-10 Low temperature and salt responsive protein family (.1) AT4G30650 47 / 4e-09 Low temperature and salt responsive protein family (.1) AT4G30660 47 / 9e-09 Low temperature and salt responsive protein family (.1.2) AT4G28088 46 / 2e-08 Low temperature and salt responsive protein family (.1) AT2G24040 45 / 4e-08 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019890 [exp] 85 / 4e-24 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 66 / 2e-16 ND 89 / 1e-25 Lus10029450 [exp] 65 / 5e-16 ND 87 / 6e-25 Lus10005948 [exp] 65 / 2e-15 ND 85 / 5e-23 Lus10040370 [exp] 59 / 1e-13 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 59 / 1e-13 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10035809 [exp] 42 / 5e-07 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2) Lus10036592 [exp] 42 / 5e-07 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G001600 [exp] 65 / 3e-16 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 62 / 5e-15 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 62 / 6e-15 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 58 / 2e-13 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 57 / 6e-13 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 47 / 1e-08 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 42 / 4e-07 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10014028 pacid=23156850 polypeptide=Lus10014028 locus=Lus10014028.g ID=Lus10014028.BGIv1.0 annot-version=v1.0 ATGTCGAGGGGAACAGATAACTTCATAGGGATAATACTGGCGATCCTGTTGCCGCCACTGGGAGTGTTCCTGAAGTTCGGGTGTGAGACGGAGTTCTGGA TCTGTTTGGTCCTCACCTTCCTTGGCTACATCCCTGGCATCGTCTACGCCGTCTACGTCATCACTAAGTGA
AA sequence Show only first row Show all	>Lus10014028 pacid=23156850 polypeptide=Lus10014028 locus=Lus10014028.g ID=Lus10014028.BGIv1.0 annot-version=v1.0 MSRGTDNFIGIILAILLPPLGVFLKFGCETEFWICLVLTFLGYIPGIVYAVYVITK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10014028 [exp]	0	1
AT5G14510			ARM repeat superfamily protein...		Lus10022275 [exp]	2.2	0.8988
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10019890 [exp]	2.4	0.8530
AT5G42250			Zinc-binding alcohol dehydroge...		Lus10040457 [exp]	3.5	0.8515
AT4G34770			SAUR-like auxin-responsive pro...		Lus10038192 [exp]	8.0	0.8442
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009627 [exp]	9.2	0.8353
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10003854 [exp]	11.0	0.8095
AT1G73300		SCPL2	serine carboxypeptidase-like 2...		Lus10012718 [exp]	11.3	0.8241
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009624 [exp]	12.4	0.8247
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010713 [exp]	14.3	0.7882
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009000 [exp]	17.5	0.8124

Compare expression of checked genes

Lus10014028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.