Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04690 91 / 3e-22 Ankyrin repeat family protein (.1) AT5G04730 83 / 1e-19 Ankyrin-repeat containing protein (.1) AT5G04700 81 / 4e-19 Ankyrin repeat family protein (.1) AT3G18670 81 / 4e-19 Ankyrin repeat family protein (.1) AT5G04680 79 / 2e-18 Ankyrin repeat family protein (.1) AT3G54070 72 / 6e-16 Ankyrin repeat family protein (.1) AT5G35810 67 / 3e-14 Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019887 [exp] 219 / 1e-68 AT5G04700 359 / 3e-113 Ankyrin repeat family protein (.1) Lus10014030 [exp] 149 / 7e-43 AT3G18670 343 / 8e-108 Ankyrin repeat family protein (.1) Lus10019888 [exp] 114 / 8e-31 AT3G18670 116 / 2e-40 Ankyrin repeat family protein (.1) Lus10038357 [exp] 114 / 1e-30 AT3G54070 389 / 2e-126 Ankyrin repeat family protein (.1) Lus10027721 [exp] 103 / 5e-27 AT3G18670 601 / 0.0 Ankyrin repeat family protein (.1) Lus10035567 [exp] 100 / 4e-26 AT3G18670 367 / 1e-121 Ankyrin repeat family protein (.1) Lus10016672 [exp] 55 / 1e-09 AT3G18670 175 / 4e-46 Ankyrin repeat family protein (.1) Lus10014701 [exp] 53 / 4e-09 AT3G18670 182 / 3e-49 Ankyrin repeat family protein (.1) Lus10000489 [exp] 50 / 5e-08 AT3G18670 180 / 1e-49 Ankyrin repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G022900 [exp] 129 / 6e-36 AT3G18670 399 / 4e-130 Ankyrin repeat family protein (.1) Potri.008G023101 [exp] 129 / 7e-36 AT5G04700 380 / 9e-122 Ankyrin repeat family protein (.1) Potri.008G023400 [exp] 122 / 3e-34 AT5G04700 336 / 8e-109 Ankyrin repeat family protein (.1) Potri.008G023500 [exp] 121 / 2e-33 AT5G04700 372 / 1e-118 Ankyrin repeat family protein (.1) Potri.008G023700 [exp] 120 / 9e-33 AT5G04700 371 / 8e-120 Ankyrin repeat family protein (.1) Potri.007G110000 [exp] 97 / 2e-24 AT3G18670 404 / 2e-133 Ankyrin repeat family protein (.1) Potri.005G057900 [exp] 93 / 3e-23 AT3G18670 431 / 4e-144 Ankyrin repeat family protein (.1) Potri.006G062700 [exp] 87 / 5e-21 AT3G54070 334 / 2e-106 Ankyrin repeat family protein (.1) Potri.006G062900 [exp] 84 / 4e-20 AT3G18670 280 / 4e-86 Ankyrin repeat family protein (.1) Potri.015G125000 [exp] 73 / 4e-16 AT3G18670 395 / 5e-128 Ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014031 pacid=23156764 polypeptide=Lus10014031 locus=Lus10014031.g ID=Lus10014031.BGIv1.0 annot-version=v1.0 ATGGCCGCAATCGAAATAAAAAGTGTGGACAGTCCGATCACCAGCTTGGTCGGCAGTGAAGAAAGGAAGTCGGCCTCTGCATATCTTGATGTGAGAATGC TCAAGAACATAAGTACCGAGGTAGAGGCGGCAAAGAGGGAAATGGAGTCGGATACTATGAAGATCTTAAAGGCCTTTTCATGGAGGAGAATTGGTATGCC GGTTTCCTGGTTGTTCCCTCCTGGAATGGTGAATGCAGCCGTGAACATGATCGTGATTATGAGAGCTCCAACGACGGTGGATGAGGTTGCCGTTTCTTTC ATCCACTTCTCTCCGGCGGATGCCAGGTCCTTGTGA
AA sequence Show only first row Show all	>Lus10014031 pacid=23156764 polypeptide=Lus10014031 locus=Lus10014031.g ID=Lus10014031.BGIv1.0 annot-version=v1.0 MAAIEIKSVDSPITSLVGSEERKSASAYLDVRMLKNISTEVEAAKREMESDTMKILKAFSWRRIGMPVSWLFPPGMVNAAVNMIVIMRAPTTVDEVAVSF IHFSPADARSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014031 [exp]	0	1
					Lus10011631 [exp]	1.4	0.9069
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	5.3	0.8772
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	6.7	0.8821
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	8.6	0.8839
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028942 [exp]	8.8	0.8602
AT1G22540			Major facilitator superfamily ...		Lus10001287 [exp]	9.4	0.8507
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028863 [exp]	10.2	0.8735
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Lus10033866 [exp]	10.4	0.8451
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028864 [exp]	10.6	0.8599
					Lus10041941 [exp]	15.3	0.8587

Compare expression of checked genes

Lus10014031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.