Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19270 143 / 1e-41 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT5G45340 130 / 6e-37 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT2G29090 128 / 4e-36 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT4G19230 128 / 5e-36 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT1G05160 95 / 7e-24 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) AT2G32440 95 / 8e-24 ATKAO2, CYP88A4, KAO2 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) AT2G42850 91 / 3e-22 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT4G36380 78 / 1e-17 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT3G44970 75 / 1e-16 Cytochrome P450 superfamily protein (.1) AT5G05690 75 / 1e-16 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019858 [exp] 168 / 1e-50 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10042652 [exp] 143 / 2e-41 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10021725 [exp] 142 / 2e-41 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10035685 [exp] 135 / 8e-39 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10033308 [exp] 135 / 1e-38 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10034768 [exp] 134 / 4e-38 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10012675 [exp] 129 / 4e-36 AT3G19270 586 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10040785 [exp] 127 / 6e-35 AT1G07510 1078 / 0.0 FTSH protease 10 (.1) Lus10016515 [exp] 121 / 2e-33 AT2G29090 554 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G029100 [exp] 142 / 3e-41 AT3G19270 665 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.004G140900 [exp] 136 / 5e-39 AT3G19270 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.002G126100 [exp] 136 / 5e-39 AT3G19270 666 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.004G235400 [exp] 135 / 1e-38 AT4G19230 778 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Potri.009G101700 [exp] 129 / 2e-36 AT3G19270 711 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.001G242600 [exp] 127 / 8e-36 AT2G29090 652 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Potri.009G033900 [exp] 126 / 2e-35 AT2G29090 677 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Potri.012G071300 [exp] 86 / 1e-20 AT1G05160 285 / 9e-91 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.002G060700 [exp] 86 / 2e-20 AT2G42850 582 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Potri.002G069600 [exp] 84 / 1e-19 AT5G45340 296 / 1e-95 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10014056 pacid=23156760 polypeptide=Lus10014056 locus=Lus10014056.g ID=Lus10014056.BGIv1.0 annot-version=v1.0 ATGATTATCGAAAAGGGCTACAATTCTTTCCCAACCAAAATCCCTGGAACTCCTTATTCCACAGCTATATCGGCAAGTATCATATTGTTTACCTTCAGAG AAGCAGTAGTCGATGTCGAATACAAAGGGTGGAAAGTGATGCCACTGTTCAGGAACATTCATCACAGGCCTGAGTTTTTCTCTGATCCTTATCATTTTGA CCCTTCTAGATTCCAGGTTCCTGTAGAGGGAAATACATTCATGCCATTTGGGAGTGGATCTCATTCTTGCCCTGGAACTCAACTTGCCAAACTTCAAATC CTCATTTTCCTCCATCACCTCCTTACTAATTTCAGGTACTTAACTGATAGGTTAGACGATATTTTACTAATTATATATATATAG
AA sequence Show only first row Show all	>Lus10014056 pacid=23156760 polypeptide=Lus10014056 locus=Lus10014056.g ID=Lus10014056.BGIv1.0 annot-version=v1.0 MIIEKGYNSFPTKIPGTPYSTAISASIILFTFREAVVDVEYKGWKVMPLFRNIHHRPEFFSDPYHFDPSRFQVPVEGNTFMPFGSGSHSCPGTQLAKLQI LIFLHHLLTNFRYLTDRLDDILLIIYI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	0	1
					Lus10002332 [exp]	2.2	1.0000
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	3.9	1.0000
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	4.5	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	4.5	1.0000
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033188 [exp]	4.6	0.8266
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	5.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	6.0	1.0000
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033189 [exp]	6.5	1.0000
AT1G61105			Toll-Interleukin-Resistance (T...		Lus10011216 [exp]	6.9	0.9048
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10033628 [exp]	6.9	1.0000

Compare expression of checked genes

Lus10014056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.