Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19270 132 / 4e-37 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT4G19230 125 / 9e-35 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT5G45340 122 / 1e-33 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT2G29090 118 / 5e-32 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT1G73340 69 / 3e-14 Cytochrome P450 superfamily protein (.1) AT4G36380 68 / 6e-14 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT5G38970 68 / 6e-14 ATBR6OX, CYP85A1, BR6OX1 brassinosteroid-6-oxidase 1 (.1.2.3) AT5G05690 67 / 7e-14 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT3G13730 66 / 3e-13 CYP90D1 "cytochrome P450, family 90, subfamily D, polypeptide 1", cytochrome P450, family 90, subfamily D, polypeptide 1 (.1) AT3G30180 66 / 4e-13 CYP85A2, BR6OX2 brassinosteroid-6-oxidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019858 [exp] 181 / 1e-55 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10042652 [exp] 134 / 1e-37 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10021725 [exp] 132 / 2e-37 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10012675 [exp] 127 / 3e-35 AT3G19270 586 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10033308 [exp] 119 / 2e-32 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10034768 [exp] 119 / 2e-32 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10035685 [exp] 118 / 4e-32 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10016515 [exp] 102 / 4e-26 AT2G29090 554 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Lus10014240 [exp] 70 / 1e-14 AT3G30180 531 / 0.0 brassinosteroid-6-oxidase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G126100 [exp] 134 / 6e-38 AT3G19270 666 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.004G140900 [exp] 134 / 7e-38 AT3G19270 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.014G029100 [exp] 134 / 9e-38 AT3G19270 665 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.009G101700 [exp] 132 / 5e-37 AT3G19270 711 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.009G033900 [exp] 125 / 2e-34 AT2G29090 677 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Potri.004G235400 [exp] 124 / 4e-34 AT4G19230 778 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Potri.001G242600 [exp] 122 / 2e-33 AT2G29090 652 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Potri.003G038200 [exp] 77 / 5e-17 AT3G13730 662 / 0.0 "cytochrome P450, family 90, subfamily D, polypeptide 1", cytochrome P450, family 90, subfamily D, polypeptide 1 (.1) Potri.017G099000 [exp] 75 / 2e-16 AT3G30180 648 / 0.0 brassinosteroid-6-oxidase 2 (.1) Potri.001G200100 [exp] 74 / 3e-16 AT3G13730 663 / 0.0 "cytochrome P450, family 90, subfamily D, polypeptide 1", cytochrome P450, family 90, subfamily D, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10014057 pacid=23156861 polypeptide=Lus10014057 locus=Lus10014057.g ID=Lus10014057.BGIv1.0 annot-version=v1.0 ATGGATGTTGTGTCCATAGTCTTCATCTACTCATGCCTTCTCCTCTCTAGCCTCCTCTTTTACCCTTTCCTCCTCAAAAACAAACATCTCTTCGATATGA AATTCAACACCATAAACAACAAGAACAAGAACAACAACAACAACAAGAACAACAACAAGAAGAATTTCAAGCTCCCTCCTGGCTCAATGGGATGGCCATA CGTTGGTGAAACCCTCCAACTCTACTCTCAACACCCTAATCACTTCTTCTCCATCAAGCACAAAAGATACGGTGAGGTATTCAAGACGAGCATCTTGGGA TGCTCGTGCGTGATTTTGGCTAGCCCCGAGGCGGCTAGGTTCGTTCTTGTGACGAATGCTCGCCTCTTCAAACCGACTTACCCCAAGTCAAAAGGAAGAG CTCATCGGGAAATGGGCTCTTTTCTTCGACCAGGGTGA
AA sequence Show only first row Show all	>Lus10014057 pacid=23156861 polypeptide=Lus10014057 locus=Lus10014057.g ID=Lus10014057.BGIv1.0 annot-version=v1.0 MDVVSIVFIYSCLLLSSLLFYPFLLKNKHLFDMKFNTINNKNKNNNNNKNNNKKNFKLPPGSMGWPYVGETLQLYSQHPNHFFSIKHKRYGEVFKTSILG CSCVILASPEAARFVLVTNARLFKPTYPKSKGRAHREMGSFLRPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014057 [exp]	0	1
					Lus10014248 [exp]	1.0	0.9060
AT5G02910			F-box/RNI-like superfamily pro...		Lus10002819 [exp]	7.4	0.7705
AT1G33530			F-box family protein (.1)		Lus10014984 [exp]	8.4	0.9030
AT1G24735			S-adenosyl-L-methionine-depend...		Lus10021804 [exp]	13.7	0.8711
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	15.9	0.8690
AT4G35620		CYCB2;2	Cyclin B2;2 (.1)		Lus10041092 [exp]	16.6	0.7039
AT2G25470		AtRLP21	receptor like protein 21 (.1)		Lus10027855 [exp]	17.7	0.8690
					Lus10021782 [exp]	19.4	0.8690
AT2G34320			Polynucleotidyl transferase, r...		Lus10039942 [exp]	21.0	0.8690
AT2G37980			O-fucosyltransferase family pr...		Lus10028253 [exp]	22.3	0.7490

Compare expression of checked genes

Lus10014057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.