Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15570 182 / 2e-59 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT3G15360 111 / 6e-31 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 100 / 4e-27 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 97 / 2e-25 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G76760 79 / 6e-19 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 79 / 1e-18 ATY2 thioredoxin Y2 (.1) AT1G52990 70 / 1e-14 thioredoxin family protein (.1) AT1G50320 69 / 1e-14 ATHX, ATX thioredoxin X (.1) AT4G12170 64 / 2e-13 Thioredoxin superfamily protein (.1) AT3G06730 61 / 8e-12 TRXz, TRXP ,TRX z thioredoxin putative plastidic, Thioredoxin z (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019847 [exp] 342 / 3e-122 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014798 [exp] 121 / 3e-35 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 121 / 3e-35 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 119 / 3e-34 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 117 / 1e-33 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 117 / 2e-33 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10018875 [exp] 72 / 3e-16 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 72 / 5e-16 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10039499 [exp] 59 / 3e-11 AT3G06730 238 / 9e-81 thioredoxin putative plastidic, Thioredoxin z (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100700 [exp] 212 / 6e-71 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 127 / 3e-37 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.011G120700 [exp] 125 / 1e-36 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.001G401500 [exp] 124 / 3e-36 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.005G186800 [exp] 115 / 7e-33 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 115 / 2e-32 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 114 / 2e-32 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 112 / 2e-31 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.007G074000 [exp] 73 / 2e-16 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.005G193400 [exp] 72 / 4e-16 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10014069 pacid=23156834 polypeptide=Lus10014069 locus=Lus10014069.g ID=Lus10014069.BGIv1.0 annot-version=v1.0 ATGGCTACTTCTGCTTCCACGTGCTTCCGCGCTCTTCCTCTCCCCGCTTCACTCCAGCTCCGTCCAGCAGCGCCACTCAGTTCTAACTCAGCAGTTTCTT TCCCGTTCGACTTCTCCGCCGACGTGAGAGGTGGATTAGCCCTCCGTTCAGCCAACCCGCGTTCGTCTTCTCCCTTCAAGGTCGTCTGCATGCGTGGATC CAAAGCAGCTGTTGTCACCAAGGACTCATGGGAGAAGTCGATCCTGAACAGCGATACCCCTGTGTTAGTCGAGTTCCATGCAAGCTGGTGTGGCCCCTGT AAGATGGTTCACCGCGTGATTGATGAGCTTGCTGTTGAATACGAAGGGAAAATCCAATGCTTTATCCTCAACGCCGACAATGATATAAAAATCGCAGAGG ACTATCAGATCAAGGCTGTACCAGTGGTCCTGCTTTTCAAGAACGGTGAAAAGCGAGAGACTGTTGTTGGAACCATGCCCAAGGAGTTCTACGCTGCTGC CATCGAGAGGGTTCTGAAGGCATGA
AA sequence Show only first row Show all	>Lus10014069 pacid=23156834 polypeptide=Lus10014069 locus=Lus10014069.g ID=Lus10014069.BGIv1.0 annot-version=v1.0 MATSASTCFRALPLPASLQLRPAAPLSSNSAVSFPFDFSADVRGGLALRSANPRSSSPFKVVCMRGSKAAVVTKDSWEKSILNSDTPVLVEFHASWCGPC KMVHRVIDELAVEYEGKIQCFILNADNDIKIAEDYQIKAVPVVLLFKNGEKRETVVGTMPKEFYAAAIERVLKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15570		TRX-M3, GAT1, A...	THIOREDOXIN-M3, GFP ARRESTED T...		Lus10014069 [exp]	0	1
AT5G42090			Lung seven transmembrane recep...		Lus10008267 [exp]	2.6	0.9227
AT5G42090			Lung seven transmembrane recep...		Lus10033235 [exp]	5.8	0.9073
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10037033 [exp]	6.0	0.8837
AT2G18840			Integral membrane Yip1 family ...		Lus10006966 [exp]	6.5	0.9070
AT2G17525			Pentatricopeptide repeat (PPR)...		Lus10035981 [exp]	6.9	0.8318
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Lus10039841 [exp]	8.2	0.9061
AT1G08750			Peptidase C13 family (.1.2.3)		Lus10006571 [exp]	9.2	0.8667
AT1G05780			Vacuolar ATPase assembly integ...		Lus10033833 [exp]	9.9	0.8843
AT5G36890		BGLU42	beta glucosidase 42 (.1.2)		Lus10020234 [exp]	10.1	0.8442
AT5G18520			Lung seven transmembrane recep...		Lus10009065 [exp]	10.2	0.9045

Compare expression of checked genes

Lus10014069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.