Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27710 84 / 2e-22 60S acidic ribosomal protein family (.1.2.3.4) AT2G27720 81 / 6e-21 60S acidic ribosomal protein family (.1.2.3) AT3G44590 79 / 4e-20 60S acidic ribosomal protein family (.1.2) AT3G28500 77 / 3e-19 60S acidic ribosomal protein family (.1) AT5G40040 72 / 2e-17 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019846 [exp] 114 / 4e-34 AT2G27710 92 / 2e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10043377 [exp] 101 / 3e-28 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4) Lus10026714 [exp] 98 / 1e-27 AT3G44590 96 / 6e-27 60S acidic ribosomal protein family (.1.2) Lus10019533 [exp] 102 / 4e-27 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2) Lus10026712 [exp] 99 / 1e-26 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2) Lus10006270 [exp] 98 / 3e-26 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4) Lus10020575 [exp] 94 / 5e-26 AT3G44590 100 / 9e-29 60S acidic ribosomal protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G146200 [exp] 96 / 7e-27 AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.004G185800 [exp] 96 / 8e-27 AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.010G236400 [exp] 82 / 2e-21 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10014070 pacid=23156824 polypeptide=Lus10014070 locus=Lus10014070.g ID=Lus10014070.BGIv1.0 annot-version=v1.0 ATGAAGGTTGTTGCCGCCTACCTGCTGGCCGTTCTGGGAGGAAACACCGCTCCCACCGCCGACGACTTGAAGTCCATCCTCGGAAGCGTGGGTGCCGATG CTGATGATACTATGATCGAGCTGCTGTTGTCTCAAGCCAAGGGAAGAGACGTCGCCGAGCTGATTGCAGTCGGTTTGGAGAAGATGGCTGCATCCGCGCC TTCTGGCGGTGGCGGTGCTGCTCCGGCGGAAGGTGGTGGTAGTGGTGCAGCAGCTCCGGCAGCTGTAGCGGCGAAGAAGGAGGAAGAGGATGTGGAAGAA AGGGAGTCTGATGATGAGGGGTTTGACCTCGACTTGTTCGGCTAA
AA sequence Show only first row Show all	>Lus10014070 pacid=23156824 polypeptide=Lus10014070 locus=Lus10014070.g ID=Lus10014070.BGIv1.0 annot-version=v1.0 MKVVAAYLLAVLGGNTAPTADDLKSILGSVGADADDTMIELLLSQAKGRDVAELIAVGLEKMAASAPSGGGGAAPAEGGGSGAAAPAAVAAKKEEEDVEE RESDDEGFDLDLFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27710			60S acidic ribosomal protein f...		Lus10014070 [exp]	0	1
AT4G18750		DOT4	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10002070 [exp]	10.4	0.7838
AT5G48600		ATSMC4, SMC4, A...	ARABIDOPSIS THALIANA STRUCTURA...		Lus10030681 [exp]	20.7	0.7083
AT4G04750			Major facilitator superfamily ...		Lus10018957 [exp]	29.8	0.7367
AT4G28940			Phosphorylase superfamily prot...		Lus10034939 [exp]	31.0	0.7721
AT1G32340		NHL8	NDR1/HIN1-like 8 (.1)		Lus10004569 [exp]	32.5	0.6893
AT4G13340		LRX3	leucine-rich repeat/extensin 3...		Lus10037905 [exp]	39.5	0.7290
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10029184 [exp]	47.7	0.7433
AT5G57280		RID2	root initiation defective 2, S...		Lus10015533 [exp]	49.6	0.7446
AT5G52450			MATE efflux family protein (.1...		Lus10001318 [exp]	54.6	0.7521
AT4G18050		ABCB9, PGP9	ATP-binding cassette B9, P-gly...		Lus10004583 [exp]	62.1	0.7137

Compare expression of checked genes

Lus10014070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.