Lus10014081 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34131 109 / 4e-28 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT2G15490 105 / 9e-28 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3)
AT4G34135 104 / 5e-27 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
AT2G15480 103 / 5e-26 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2)
AT4G34138 102 / 1e-25 UGT73B1 UDP-glucosyl transferase 73B1 (.1)
AT2G36780 89 / 7e-21 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36760 87 / 2e-20 UGT73C2 UDP-glucosyl transferase 73C2 (.1)
AT2G36770 86 / 5e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36790 86 / 1e-19 UGT73C6 UDP-glucosyl transferase 73C6 (.1)
AT2G36750 84 / 3e-19 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019833 131 / 3e-36 AT2G15480 483 / 2e-168 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014082 128 / 4e-35 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014086 108 / 7e-28 AT2G15490 496 / 4e-173 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014083 107 / 2e-27 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1)
Lus10019832 106 / 5e-27 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014084 105 / 7e-27 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10019835 100 / 9e-25 AT2G15480 476 / 3e-165 UDP-glucosyl transferase 73B5 (.1.2)
Lus10016268 96 / 3e-23 AT2G36780 498 / 1e-173 UDP-Glycosyltransferase superfamily protein (.1)
Lus10014402 96 / 3e-23 AT2G36780 474 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G098966 133 / 5e-37 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303300 131 / 2e-36 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G303700 131 / 2e-36 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.009G099032 129 / 1e-35 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G303600 124 / 1e-33 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303000 122 / 9e-33 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.009G098400 120 / 5e-32 AT2G15490 505 / 8e-177 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G302400 118 / 1e-31 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G302300 112 / 2e-29 AT4G34131 488 / 4e-170 UDP-glucosyl transferase 73B3 (.1)
Potri.002G123700 88 / 2e-20 AT4G34131 446 / 3e-153 UDP-glucosyl transferase 73B3 (.1)
PFAM info
Representative CDS sequence
>Lus10014081 pacid=23156785 polypeptide=Lus10014081 locus=Lus10014081.g ID=Lus10014081.BGIv1.0 annot-version=v1.0
ATGGACAGTTTGAATCCCTCCGTCGGCGACCACCAACTGCACGTCTTCTTCTTCCCGTTCATGGCCCACGGCCACATGATTCCGGCCATCGACATGGCCG
AGGTCTTCGCTTCTCGAGGCGTCAAGGTGACCATCATCACCACTCCTCTTAACGCCCCGCTCTTCTCCAAGACTATCACCAAGCACTCCGAGTCCACAGG
GTCCGATATTCGGATTCGAATCCTCGAATTCCCAACTGCCAAGTTTGGACTTCCGGAAGGATGCGAGAACGCTGACGTTATCACTTCCATGAACTTGGGG
TGGGAGACCGACTTTATTTGCCGCGGCAAACAAATTGCACACAGGGAAGATCGGAGTTCAAGTCGGAGCGGCACAATCACGACGATTGAGGGTGCAAAGG
TGGAGAGGGCTATAAGGAAGATTATGTCGACGGATGATGAAGAGATGGCGGAGATGCGAAGTGAAGCGAAAAGTTTAGGAGAGATGATAAAGAAGGCGGT
GGAAGAAGGTGAATCTTCCTATTGCGATTTGGATTCTCGCTAA
AA sequence
>Lus10014081 pacid=23156785 polypeptide=Lus10014081 locus=Lus10014081.g ID=Lus10014081.BGIv1.0 annot-version=v1.0
MDSLNPSVGDHQLHVFFFPFMAHGHMIPAIDMAEVFASRGVKVTIITTPLNAPLFSKTITKHSESTGSDIRIRILEFPTAKFGLPEGCENADVITSMNLG
WETDFICRGKQIAHREDRSSSRSGTITTIEGAKVERAIRKIMSTDDEEMAEMRSEAKSLGEMIKKAVEEGESSYCDLDSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Lus10014081 0 1

Lus10014081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.