Lus10014085 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49750 190 / 4e-58 Leucine-rich repeat (LRR) family protein (.1)
AT3G19320 179 / 6e-54 Leucine-rich repeat (LRR) family protein (.1)
AT4G06744 135 / 4e-38 Leucine-rich repeat (LRR) family protein (.1)
AT2G15880 105 / 3e-26 Leucine-rich repeat (LRR) family protein (.1)
AT4G33970 98 / 8e-24 Leucine-rich repeat (LRR) family protein (.1)
AT4G28380 92 / 9e-22 Leucine-rich repeat (LRR) family protein (.1)
AT3G24480 91 / 2e-21 Leucine-rich repeat (LRR) family protein (.1)
AT3G19020 91 / 3e-21 Leucine-rich repeat (LRR) family protein (.1)
AT4G13340 88 / 2e-20 LRX3 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
AT1G49490 86 / 2e-19 Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019830 345 / 2e-120 AT1G49750 375 / 2e-127 Leucine-rich repeat (LRR) family protein (.1)
Lus10002828 229 / 1e-74 AT3G19320 372 / 1e-126 Leucine-rich repeat (LRR) family protein (.1)
Lus10027878 229 / 5e-73 AT3G19320 408 / 2e-138 Leucine-rich repeat (LRR) family protein (.1)
Lus10010049 116 / 9e-31 AT4G06744 442 / 2e-154 Leucine-rich repeat (LRR) family protein (.1)
Lus10012047 100 / 2e-24 AT3G19020 508 / 6e-172 Leucine-rich repeat (LRR) family protein (.1)
Lus10027935 97 / 3e-23 AT1G49490 538 / 6e-180 Leucine-rich repeat (LRR) family protein (.1)
Lus10017727 92 / 1e-21 AT3G24480 611 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10033672 91 / 2e-21 AT4G28380 488 / 6e-173 Leucine-rich repeat (LRR) family protein (.1)
Lus10037905 84 / 9e-19 AT4G13340 432 / 9e-149 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G098601 214 / 2e-67 AT3G19320 421 / 5e-143 Leucine-rich repeat (LRR) family protein (.1)
Potri.001G302500 143 / 7e-41 AT4G06744 411 / 5e-142 Leucine-rich repeat (LRR) family protein (.1)
Potri.009G098700 136 / 4e-38 AT4G06744 405 / 9e-140 Leucine-rich repeat (LRR) family protein (.1)
Potri.014G024300 131 / 2e-36 AT4G06744 449 / 6e-157 Leucine-rich repeat (LRR) family protein (.1)
Potri.004G146350 99 / 4e-24 AT2G15880 600 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.009G108100 96 / 6e-23 AT3G19020 567 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.006G158814 91 / 4e-21 AT3G24480 614 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G075900 89 / 1e-20 AT3G24480 603 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.007G139200 88 / 2e-20 AT4G28380 503 / 9e-179 Leucine-rich repeat (LRR) family protein (.1)
Potri.010G083000 86 / 9e-20 AT3G22800 477 / 7e-167 Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10014085 pacid=23156816 polypeptide=Lus10014085 locus=Lus10014085.g ID=Lus10014085.BGIv1.0 annot-version=v1.0
ATGTACTTGACATTCGCTAACAACCGATTCTCAGGCCAGATCCCGAGGAGCATCGGTAGGTGCGAGAACCTTCTCGAAGTGCTGCTCCTCAACAACCGAT
TCTCGGGATGTTTGCCGACGGAGATAGGGAATCTAACCAAGGCGAGGATATTCGACGCCGGGAATAACAAACTCACCGGTCCGATTCCTCACTCGTTTGC
TTGCCTAGCCGAGATGCGAGATCTGAATCTGGCTCGGAACAAGCTGTACGGCGCTGTACCGGAGAGCGTGTGCCAGCTGCCGAAGCTCACGAATCTGTCG
CTGTCGTCGAACTACTTGACGCAGGTGGGGCCCGCCTGCAGAAAGCTGATCGATAGAAAGGTCCTGGATGTGAAGGATAACTGTATTCTGGATCTGCCGG
GGCAGAAATCGGCGGAGGAATGCGGCAAGTTTTTCTCCGGGAGAACTAACTGCCCAAACGTGAAGACATTGATGAGCTACATCCCTTGTAAGAAAGGGGA
GAATTCCGATCGGAAATTGGCGGCGGTGGATGAAGAATCGGTGCCGGCTCCGGTGTCGTTCGCGTACCTTGCGTTGAAGCCTCACAAGTTGAGATGA
AA sequence
>Lus10014085 pacid=23156816 polypeptide=Lus10014085 locus=Lus10014085.g ID=Lus10014085.BGIv1.0 annot-version=v1.0
MYLTFANNRFSGQIPRSIGRCENLLEVLLLNNRFSGCLPTEIGNLTKARIFDAGNNKLTGPIPHSFACLAEMRDLNLARNKLYGAVPESVCQLPKLTNLS
LSSNYLTQVGPACRKLIDRKVLDVKDNCILDLPGQKSAEECGKFFSGRTNCPNVKTLMSYIPCKKGENSDRKLAAVDEESVPAPVSFAYLALKPHKLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49750 Leucine-rich repeat (LRR) fami... Lus10014085 0 1
AT5G19760 Mitochondrial substrate carrie... Lus10030361 2.0 0.8676
AT4G21150 HAP6 HAPLESS 6, ribophorin II (RPN2... Lus10024911 7.1 0.8558
AT1G64650 Major facilitator superfamily ... Lus10017322 8.3 0.8455
AT5G12860 DIT1 dicarboxylate transporter 1 (.... Lus10002560 12.5 0.8206
AT4G18030 S-adenosyl-L-methionine-depend... Lus10011045 13.6 0.8271
AT1G32860 Glycosyl hydrolase superfamily... Lus10033244 14.7 0.8257
AT5G64290 DCT, DIT2.1 dicarboxylate transport 2.1 (.... Lus10023779 17.3 0.8190
AT3G05420 ACBP4 acyl-CoA binding protein 4 (.1... Lus10015176 18.9 0.8336
AT5G64970 Mitochondrial substrate carrie... Lus10014334 19.4 0.8243
AT3G19870 unknown protein Lus10030556 20.9 0.8331

Lus10014085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.