Lus10014099 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019815 344 / 2e-123 ND /
Lus10014101 342 / 2e-122 ND /
Lus10019813 339 / 2e-121 ND /
Lus10028949 304 / 3e-107 ND /
Lus10024445 229 / 6e-78 ND /
Lus10037860 221 / 3e-74 ND /
Lus10000191 212 / 9e-71 ND /
Lus10039879 211 / 2e-70 ND /
Lus10029851 206 / 3e-68 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081800 276 / 3e-96 ND /
Potri.002G158600 274 / 2e-95 ND /
Potri.002G158700 270 / 5e-94 ND /
Potri.019G100100 265 / 1e-91 ND /
Potri.014G082700 265 / 1e-91 ND /
Potri.014G081900 256 / 4e-88 ND /
Potri.014G082000 228 / 3e-77 ND /
Potri.003G126200 224 / 1e-75 ND /
Potri.017G153100 152 / 8e-47 ND /
Potri.003G126400 141 / 1e-43 ND /
PFAM info
Representative CDS sequence
>Lus10014099 pacid=23156790 polypeptide=Lus10014099 locus=Lus10014099.g ID=Lus10014099.BGIv1.0 annot-version=v1.0
ATGGCCGCCAACATCGAGGCACAGAGCTGCAAGCCAAGTGGTTACATAACGGGGATCACTCCCCCGCCGGGGCAATGCAACCAGGGTGAAGAATCCGACT
GTTGTAAGGCGGGCAAACACTACACCACCTACAAATGCTCGCCTCCGGTGACTGGCCGAACCAAGGCGACTTTGACTTGGAACAGCTTCGAGAAAGGAGG
GAGTGGAGGTGGACCGTCCGAGTGCGATAACAAGTACCACCCCGATGACCATCCTGTGGTCGCGTTGTCGACCGGATGGTTCAACAACAAAAGCAGGTGT
CTCAACTTTATCAACATTTATGGGAATGGGAAGAGTGTTAGGGCCATGGTGGTTGATGAGTGCGACTCTACTATGGGTTGTGATTCTGACCATGATTATC
AGCCTCCTTGTCCCAACAACATCGTTGATGCATCAAAAGCTGTCTGGAAAGCATTGGGAGTGTCCGAAGATAACTGGGGTGATCTTGATATCTCTTGGTC
TGATGCTTGA
AA sequence
>Lus10014099 pacid=23156790 polypeptide=Lus10014099 locus=Lus10014099.g ID=Lus10014099.BGIv1.0 annot-version=v1.0
MAANIEAQSCKPSGYITGITPPPGQCNQGEESDCCKAGKHYTTYKCSPPVTGRTKATLTWNSFEKGGSGGGPSECDNKYHPDDHPVVALSTGWFNNKSRC
LNFINIYGNGKSVRAMVVDECDSTMGCDSDHDYQPPCPNNIVDASKAVWKALGVSEDNWGDLDISWSDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10014099 0 1
AT1G31930 XLG3 extra-large GTP-binding protei... Lus10024210 1.0 1.0000
Lus10005838 5.7 0.8390
Lus10010697 7.7 0.7821
AT1G50750 Plant mobile domain protein fa... Lus10036654 8.9 0.6063
AT4G13230 Late embryogenesis abundant pr... Lus10022822 8.9 0.7821
AT5G49360 ATBXL1, BXL1 beta-xylosidase 1 (.1) Lus10037728 9.8 0.7796
AT5G20610 unknown protein Lus10025003 10.0 0.7821
Lus10008327 11.0 0.7821
AT2G27110 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.... Lus10008762 11.8 0.7821
AT5G12480 CPK7 calmodulin-domain protein kina... Lus10026300 13.4 0.7636

Lus10014099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.