Lus10014101 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019813 349 / 3e-125 ND /
Lus10019815 342 / 1e-122 ND /
Lus10014099 342 / 2e-122 ND /
Lus10028949 306 / 5e-108 ND /
Lus10024445 231 / 9e-79 ND /
Lus10037860 223 / 5e-75 ND /
Lus10000191 209 / 3e-69 ND /
Lus10039879 207 / 6e-69 ND /
Lus10029851 207 / 1e-68 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081800 279 / 3e-97 ND /
Potri.002G158600 276 / 3e-96 ND /
Potri.002G158700 273 / 7e-95 ND /
Potri.014G082700 267 / 9e-93 ND /
Potri.019G100100 263 / 6e-91 ND /
Potri.014G081900 256 / 2e-88 ND /
Potri.014G082000 231 / 2e-78 ND /
Potri.003G126200 223 / 2e-75 ND /
Potri.017G153100 149 / 1e-45 ND /
Potri.003G126400 138 / 2e-42 ND /
PFAM info
Representative CDS sequence
>Lus10014101 pacid=23156801 polypeptide=Lus10014101 locus=Lus10014101.g ID=Lus10014101.BGIv1.0 annot-version=v1.0
ATGGCCGCGAAGATCGAGGCACAGAGCTGCAAGCCGAGTGGTTACATAACGGGGATCACTCCACCACCAGGGCAATGCAACCAGGGAGAAGAATCTGACT
GCTGTAAAGCAGGCAAGCACTACACCACCTACAAATGTTCACCCCCGGTGACTGGTCGCACCAAGGCGACTCTGACTTGGAACAGCTTTGAGAAAGGAGG
GAGTGGAGGAGGGCCATCCGAGTGCGATAACAAGTACCACCCCGATGATCATCCAGTGGTAGCGTTGTCGACTGGATGGTTCAATAACAAGAGTAGGTGT
CTCAACTTTATAAACATTCACGGGAATGGGAAGACTGTTAGGGCAATGGTCGTAGATGAGTGTGACTCTACCATGGGGTGTGATTCTGACCATGATTATC
AGCCTCCATGTCCTGACAACATTGTTGACGCATCGAAAGCGGTCTGGAAAGCTTTGGGGGTGCCCGAGGATAATTGGGGTGATCTTGATATCACCTGGTC
CGATGCTTGA
AA sequence
>Lus10014101 pacid=23156801 polypeptide=Lus10014101 locus=Lus10014101.g ID=Lus10014101.BGIv1.0 annot-version=v1.0
MAAKIEAQSCKPSGYITGITPPPGQCNQGEESDCCKAGKHYTTYKCSPPVTGRTKATLTWNSFEKGGSGGGPSECDNKYHPDDHPVVALSTGWFNNKSRC
LNFINIHGNGKTVRAMVVDECDSTMGCDSDHDYQPPCPDNIVDASKAVWKALGVPEDNWGDLDITWSDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10014101 0 1
AT1G11340 S-locus lectin protein kinase ... Lus10036139 11.4 0.8690
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10005551 13.5 0.8568
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10029900 15.7 0.8404
Lus10034718 15.9 0.8450
AT2G27410 B3 Domain of unknown function (DU... Lus10027284 17.2 0.8612
AT1G24540 CYP86C1 "cytochrome P450, family 86, s... Lus10006232 18.1 0.8555
AT1G24590 AP2_ERF ESR2, DRNL, SOB... FOR SUPPRESSOR OF PHYTOCHROMEB... Lus10017907 19.9 0.7900
AT1G14750 SDS SOLO DANCERS, Cyclin family pr... Lus10021812 25.5 0.7978
AT5G48140 Pectin lyase-like superfamily ... Lus10013780 26.3 0.8512
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10028145 28.2 0.8515

Lus10014101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.