Lus10014102 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19460 153 / 5e-47 Reticulon family protein (.1.2)
AT2G15280 150 / 1e-45 Reticulon family protein (.1.2)
AT3G54120 100 / 2e-26 Reticulon family protein (.1)
AT3G10915 96 / 2e-24 Reticulon family protein (.1.2.3.4.5.6)
AT4G23630 93 / 8e-23 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
AT2G46170 92 / 1e-22 Reticulon family protein (.1.2)
AT1G64090 92 / 1e-22 RTNLB3 Reticulan like protein B3 (.1.2)
AT4G11220 91 / 5e-22 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
AT3G61560 86 / 3e-20 Reticulon family protein (.1.2)
AT3G10260 86 / 4e-20 Reticulon family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019812 311 / 5e-109 AT3G19460 208 / 1e-68 Reticulon family protein (.1.2)
Lus10002815 185 / 3e-59 AT3G19460 188 / 1e-60 Reticulon family protein (.1.2)
Lus10027867 183 / 3e-58 AT3G19460 184 / 1e-58 Reticulon family protein (.1.2)
Lus10027756 103 / 3e-27 AT3G54120 181 / 1e-57 Reticulon family protein (.1)
Lus10035537 102 / 8e-27 AT3G54120 185 / 2e-59 Reticulon family protein (.1)
Lus10036405 97 / 3e-24 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2)
Lus10038833 95 / 1e-23 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
Lus10041080 95 / 2e-23 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2)
Lus10032451 94 / 2e-23 AT3G18260 268 / 9e-92 Reticulon family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G300400 192 / 3e-62 AT3G19460 145 / 8e-44 Reticulon family protein (.1.2)
Potri.009G096200 164 / 4e-51 AT2G15280 132 / 1e-38 Reticulon family protein (.1.2)
Potri.016G110200 122 / 8e-35 AT3G54120 193 / 1e-62 Reticulon family protein (.1)
Potri.015G027300 101 / 4e-26 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.012G035600 100 / 8e-26 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.003G133600 99 / 3e-25 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.001G097700 99 / 4e-25 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.005G206800 97 / 2e-24 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3)
Potri.019G057400 96 / 3e-24 AT3G10915 260 / 6e-88 Reticulon family protein (.1.2.3.4.5.6)
Potri.014G091200 96 / 7e-24 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF02453 Reticulon Reticulon
Representative CDS sequence
>Lus10014102 pacid=23156828 polypeptide=Lus10014102 locus=Lus10014102.g ID=Lus10014102.BGIv1.0 annot-version=v1.0
ATGGAAGGTAGCTCCGTCAGTACATTCCCTCATCCTCGTCCCATTTCCGTCCACCAGCTGCTTGGCGGGGGTTCAGTCGCTGATGTGCTGCTGTGGCTGA
GATTGGGCGGGAGCTTGACGTTGTTATTGGCTTCGACGATTGCGTGGATTCTGTTCGAGATAGCGGGTTACAGTTTGCTGACCTTCGTGGCGAATGTGTT
GTTCCTCCTCGCCGCAATTCTCTTCCTGTGGGCGAAATCTGCTTCTCTTCTCAATCGGCCACTGCCGCCAATTCCTGATCTGAAAATAACTGAGGAGACC
ATTGACAAGGTTGCTCAAGTTCTTCAAGTTTATGTCAACCGTGTATTAGCAATTGGATCTGACATCGCAATTGGAAGAAATTCAAAAGTTTTCTTACAGG
TCGCTTTTACGTTGTGGATCGTTTCTTATCTCGGTAGCCTCTGCGGTTTCCTTACTTGTGTGTACATTGGGATTCTTCTGAGTCTTTCAATCCCGGTGCT
TTATGACAAATACCAGCACCAGATTGATGAAAAGCTTCTTGTAGCACAGACAATTCTTGAAGCTCAGCTTAGGAAAATTGATCATTTTCTGAAGAAAGTT
CCACTGCCATCAAACAAGGAAAAGAAGGTTCAATAG
AA sequence
>Lus10014102 pacid=23156828 polypeptide=Lus10014102 locus=Lus10014102.g ID=Lus10014102.BGIv1.0 annot-version=v1.0
MEGSSVSTFPHPRPISVHQLLGGGSVADVLLWLRLGGSLTLLLASTIAWILFEIAGYSLLTFVANVLFLLAAILFLWAKSASLLNRPLPPIPDLKITEET
IDKVAQVLQVYVNRVLAIGSDIAIGRNSKVFLQVAFTLWIVSYLGSLCGFLTCVYIGILLSLSIPVLYDKYQHQIDEKLLVAQTILEAQLRKIDHFLKKV
PLPSNKEKKVQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19460 Reticulon family protein (.1.2... Lus10014102 0 1
AT5G53070 Ribosomal protein L9/RNase H1 ... Lus10005909 5.1 0.8975
AT1G13580 LOH3, LAG13 LAG One Homologue 3, LAG1 long... Lus10030571 8.2 0.9123
AT4G27740 Yippee family putative zinc-bi... Lus10023244 8.8 0.9039
AT4G32440 Plant Tudor-like RNA-binding p... Lus10018749 10.2 0.9093
AT4G27120 unknown protein Lus10011161 11.1 0.9100
AT1G54650 Methyltransferase family prote... Lus10005515 11.8 0.8935
AT1G25260 Ribosomal protein L10 family p... Lus10030073 12.9 0.8692
AT5G03460 unknown protein Lus10023922 13.4 0.8935
AT5G41210 GSTU12, GST10, ... glutathione S-transferase THET... Lus10008021 17.3 0.9117
AT5G06340 ATNUDX27 nudix hydrolase homolog 27 (.1... Lus10016955 19.4 0.8946

Lus10014102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.