Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35070 171 / 9e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT3G12920 114 / 9e-31 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT1G45976 105 / 2e-27 SBP1 S-ribonuclease binding protein 1 (.1) AT1G79110 104 / 1e-26 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT5G45100 98 / 7e-25 BRG1 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT4G19700 97 / 3e-24 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1) AT1G32740 93 / 1e-22 SBP (S-ribonuclease binding protein) family protein (.1) AT1G60610 92 / 2e-22 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT5G47050 91 / 9e-22 SBP (S-ribonuclease binding protein) family protein (.1) AT1G10650 88 / 5e-21 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019790 [exp] 391 / 8e-141 AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10017276 [exp] 154 / 4e-47 AT4G35070 122 / 2e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013569 [exp] 151 / 7e-45 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10031780 [exp] 110 / 5e-29 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10013027 [exp] 100 / 4e-25 AT1G10650 382 / 3e-133 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030891 [exp] 98 / 7e-25 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10001131 [exp] 99 / 1e-24 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10031202 [exp] 97 / 4e-24 AT3G12920 255 / 3e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10030599 [exp] 97 / 4e-24 AT1G10650 380 / 4e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175500 [exp] 236 / 6e-79 AT4G35070 142 / 1e-41 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.009G135400 [exp] 224 / 3e-74 AT4G35070 135 / 6e-39 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G019000 [exp] 189 / 4e-60 AT4G35070 148 / 6e-43 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.005G242600 [exp] 175 / 9e-55 AT4G35070 135 / 3e-38 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.001G439600 [exp] 110 / 5e-29 AT3G12920 256 / 1e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.015G118000 [exp] 109 / 7e-29 AT5G45100 259 / 2e-85 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.012G119200 [exp] 103 / 1e-26 AT5G45100 244 / 1e-79 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.014G027000 [exp] 102 / 3e-26 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.012G082200 [exp] 102 / 7e-26 AT1G10650 266 / 2e-87 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.011G142700 [exp] 101 / 1e-25 AT3G12920 233 / 1e-74 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014118 pacid=23156825 polypeptide=Lus10014118 locus=Lus10014118.g ID=Lus10014118.BGIv1.0 annot-version=v1.0 ATGGTGGGGAACCCTCCTCTTCAATCCATGGCCGCTTTTGAGCAGAAGCAGAGGCAAGAAATCGACCACTATATCAGATTACAGAACGAGAGGCTTCGGA TGATGCTGCAAGAACAGAGGAAGCAACAGCTCGCCGTGCTCCTAAAATCAATCGAGTCAAAGGCGACGGTCCTCCTACAGCAAAAGGACGACGAAATATC GCTGGTGACGAAGCGAGCGACGGAGATGGAACTCGTGATGAAACGCCTGGAAATGGAGAACCAAGCGTGGCAGAGGATCGCAAAGGAGAACGAAGCGGCG GTGATCTCGCTCAACAACACTCTGGAACAAGTCAGGGAGAGCTCCTCGCTAATGATGATGGTTAATCACAACAACGGGGAGGAAGACGCAGAGTCGTGCT GTTCCGGTAACGACGTTAATAACAAAACGGACGCGGCGGCGGGACGGGTGTGTAAAGGGTGCAATTCTAGGGGAGCGTGCGTATTGTTCTTGCCGTGCAG GCATCTCTGTTCATGCAACGTCTGTGAGGGGTTTCTGGGCAGCTGCCCTGTCTGTCGTACGCCGAAGAAAGCCAGCATTGAGGCATTAATGGGCTGA
AA sequence Show only first row Show all	>Lus10014118 pacid=23156825 polypeptide=Lus10014118 locus=Lus10014118.g ID=Lus10014118.BGIv1.0 annot-version=v1.0 MVGNPPLQSMAAFEQKQRQEIDHYIRLQNERLRMMLQEQRKQQLAVLLKSIESKATVLLQQKDDEISLVTKRATEMELVMKRLEMENQAWQRIAKENEAA VISLNNTLEQVRESSSLMMMVNHNNGEEDAESCCSGNDVNNKTDAAAGRVCKGCNSRGACVLFLPCRHLCSCNVCEGFLGSCPVCRTPKKASIEALMG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10014118 [exp]	0	1
AT5G53120		SPMS, SPDS3, AT...	spermidine synthase 3 (.1.2.3....		Lus10003398 [exp]	3.5	0.8507
AT1G11050			Protein kinase superfamily pro...		Lus10012701 [exp]	4.0	0.8379
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10008743 [exp]	5.7	0.8269
AT1G28280			VQ motif-containing protein (....		Lus10015315 [exp]	8.7	0.7657
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017076 [exp]	10.6	0.7853
AT2G17420		NTR2, ATNTRA, N...	NADPH-DEPENDENT THIOREDOXIN RE...		Lus10037596 [exp]	11.8	0.8104
AT1G19140			unknown protein		Lus10027662 [exp]	14.8	0.7750
AT1G55910		ZIP11	zinc transporter 11 precursor ...		Lus10016609 [exp]	19.1	0.8276
AT1G11050			Protein kinase superfamily pro...		Lus10001295 [exp]	19.6	0.8102
AT4G13510		ATAMT1;1, AMT1;...	ARABIDOPSIS THALIANA AMMONIUM ...		Lus10023705 [exp]	22.4	0.7992

Compare expression of checked genes

Lus10014118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.