Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 102 / 2e-29 LTP4 lipid transfer protein 4 (.1) AT5G59320 100 / 3e-28 LTP3 lipid transfer protein 3 (.1) AT2G15050 94 / 9e-26 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 92 / 2e-25 LTP12 lipid transfer protein 12 (.1) AT3G51600 85 / 2e-22 LTP5 lipid transfer protein 5 (.1) AT5G01870 85 / 2e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38540 85 / 2e-22 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G38530 83 / 9e-22 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT4G33355 78 / 9e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G08770 77 / 2e-19 LTP6 lipid transfer protein 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022745 [exp] 223 / 4e-77 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025151 [exp] 118 / 1e-35 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025231 [exp] 115 / 3e-34 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10026418 [exp] 112 / 4e-33 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025234 [exp] 107 / 4e-31 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10015279 [exp] 105 / 1e-30 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10007280 [exp] 100 / 2e-28 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 97 / 4e-27 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10015278 [exp] 95 / 2e-26 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 111 / 1e-32 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 110 / 1e-32 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 105 / 1e-30 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 103 / 7e-30 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 96 / 1e-26 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 86 / 6e-23 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 86 / 1e-22 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 86 / 1e-22 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 82 / 3e-21 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.014G046500 [exp] 80 / 1e-20 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10014167 pacid=23152949 polypeptide=Lus10014167 locus=Lus10014167.g ID=Lus10014167.BGIv1.0 annot-version=v1.0 ATGGCTGCCGCTCTGAAGATGAAGATGACGTCATTCCTCGTCGTCTCCATCGTTGTCATGTCTGCACCGATGAGGCCGACCCACGGCGCCATCACGTGCA TGCAAGTGATGAGCAGCCTGTCCCCGTGCGTCTATTACTTGGTCGGCGGCGGGCAGGTCTCCGCACCATGCTGCAGCGGCGTGAGGGCGCTGAACGACGC CGCAGTCACCACCGTTGACCGCCGGCAGGCTTGCCAGTGCTTGAAGACTGCCGCCGCCGGTGTCCCTGGCTTGCAGGTCCCGCTTGCCAGTGCCCTCCCC GGCCAGTGTGGGGTCCACATTCCTTACGAGATCAGCCCCAACACCGACTGCAACTCGTAA
AA sequence Show only first row Show all	>Lus10014167 pacid=23152949 polypeptide=Lus10014167 locus=Lus10014167.g ID=Lus10014167.BGIv1.0 annot-version=v1.0 MAAALKMKMTSFLVVSIVVMSAPMRPTHGAITCMQVMSSLSPCVYYLVGGGQVSAPCCSGVRALNDAAVTTVDRRQACQCLKTAAAGVPGLQVPLASALP GQCGVHIPYEISPNTDCNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10014167 [exp]	0	1
AT5G59010			Protein kinase protein with te...		Lus10016454 [exp]	8.3	0.8842
AT5G51800	Trihelix		Protein kinase superfamily pro...		Lus10031672 [exp]	19.6	0.8596
AT1G24100		UGT74B1	UDP-glucosyl transferase 74B1 ...		Lus10010712 [exp]	23.3	0.8552
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10023458 [exp]	24.1	0.8590
AT2G42840		PDF1	protodermal factor 1 (.1)		Lus10007351 [exp]	27.3	0.8590
AT3G22590		PHP, CDC73	PLANT HOMOLOGOUS TO PARAFIBROM...		Lus10026680 [exp]	28.5	0.8583
AT3G58760			Integrin-linked protein kinase...		Lus10037851 [exp]	30.9	0.8422
AT2G40010			Ribosomal protein L10 family p...		Lus10040214 [exp]	33.1	0.8572
AT2G38720		MAP65-5	microtubule-associated protein...		Lus10026114 [exp]	36.1	0.8531
AT2G40010			Ribosomal protein L10 family p...		Lus10028276 [exp]	37.0	0.8571

Compare expression of checked genes

Lus10014167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.