Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025225 [exp] 91 / 2e-24 ND / Lus10025141 [exp] 81 / 7e-20 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G136800 [exp] 76 / 2e-18 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014171 pacid=23152956 polypeptide=Lus10014171 locus=Lus10014171.g ID=Lus10014171.BGIv1.0 annot-version=v1.0 ATGGAAGTTGTCGCGGTGAAGAGATTCGGCGATGAGCAGAGCACTCTGCTCGACAGATTCGAGAGGGTGTCGTTTGAGGTGCAGCTTAACAGAGCTATAC TCGCTCGCAGCCTATCTGAGCCCGGAGGACCAGGTCGAACCCGGCGGAAGAAAGATGGTAGTAGTAGTAGTAGTGTTGTTTTCCGGTCGGGTCTGAACAG GTTTCTGAAGAAGCTGCTGAAACCCATTATGGGAAGAAAGAAGAAGACGACGGTCAACGAGTCAACTCAGCATGAGGATGAGGGTTCCCTAGCCGTTGGG AAAGGGGAAGTGAAATTCATCAAGGGGGGTTTTAGCAGATCCGTCAGGTTTTGA
AA sequence Show only first row Show all	>Lus10014171 pacid=23152956 polypeptide=Lus10014171 locus=Lus10014171.g ID=Lus10014171.BGIv1.0 annot-version=v1.0 MEVVAVKRFGDEQSTLLDRFERVSFEVQLNRAILARSLSEPGGPGRTRRKKDGSSSSSVVFRSGLNRFLKKLLKPIMGRKKKTTVNESTQHEDEGSLAVG KGEVKFIKGGFSRSVRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014171 [exp]	0	1
AT1G27170			transmembrane receptors;ATP bi...		Lus10032101 [exp]	5.1	0.8967
AT1G75260			oxidoreductases, acting on NAD...		Lus10033210 [exp]	5.9	0.9366
AT1G75260			oxidoreductases, acting on NAD...		Lus10010832 [exp]	7.5	0.9310
AT1G11570		NTL	NTF2-like (.1.2)		Lus10020061 [exp]	8.9	0.9054
AT1G63310			unknown protein		Lus10008287 [exp]	9.3	0.9246
AT1G49780		PUB26	plant U-box 26 (.1)		Lus10019842 [exp]	11.9	0.8709
AT4G34180			Cyclase family protein (.1)		Lus10001508 [exp]	12.1	0.8704
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10011827 [exp]	12.7	0.9083
AT4G24250		ATMLO13, MLO13	MILDEW RESISTANCE LOCUS O 13, ...		Lus10042397 [exp]	14.4	0.9150
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Lus10039702 [exp]	14.7	0.9118

Compare expression of checked genes

Lus10014171 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.