Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G22120 70 / 5e-16 RING/FYVE/PHD zinc finger superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019687 [exp] 94 / 4e-25 AT2G22120 546 / 0.0 RING/FYVE/PHD zinc finger superfamily protein (.1.2) Lus10016426 [exp] 94 / 4e-25 AT2G22120 543 / 0.0 RING/FYVE/PHD zinc finger superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G085900 [exp] 76 / 1e-18 AT2G22120 388 / 4e-136 RING/FYVE/PHD zinc finger superfamily protein (.1.2) Potri.005G081500 [exp] 76 / 2e-18 AT2G22120 521 / 0.0 RING/FYVE/PHD zinc finger superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014172 pacid=23152942 polypeptide=Lus10014172 locus=Lus10014172.g ID=Lus10014172.BGIv1.0 annot-version=v1.0 ATGGCTGATCAAGCCGACTCGTCGCCGCTCGTCCCTCCTACGCCGATCACCAGTGAGGAATCCGAGATCGACCTCGAGGCCGGCCCTGGTGACCAAATTC AGTGCCGAATTTGCCTCGAAACTGACGGTAGGGACTTCTTTCCTTACTTTGTTCTCCGTTCTCCGCTTAACTGA
AA sequence Show only first row Show all	>Lus10014172 pacid=23152942 polypeptide=Lus10014172 locus=Lus10014172.g ID=Lus10014172.BGIv1.0 annot-version=v1.0 MADQADSSPLVPPTPITSEESEIDLEAGPGDQIQCRICLETDGRDFFPYFVLRSPLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G22120			RING/FYVE/PHD zinc finger supe...		Lus10014172 [exp]	0	1
AT1G09750			Eukaryotic aspartyl protease f...		Lus10014173 [exp]	1.4	0.8686
AT2G40820			unknown protein		Lus10038998 [exp]	4.5	0.8669
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10023190 [exp]	5.7	0.8155
AT3G52900			Family of unknown function (DU...		Lus10043423 [exp]	5.9	0.8164
AT1G11080		SCPL31	serine carboxypeptidase-like 3...		Lus10018467 [exp]	6.0	0.7917
AT3G48750		CDKA1, CDC2A, C...	cell division control 2 (.1)		Lus10038754 [exp]	6.0	0.8379
AT1G69160			unknown protein		Lus10019172 [exp]	6.6	0.8176
AT3G50780			unknown protein		Lus10022484 [exp]	7.3	0.8164
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Lus10039151 [exp]	10.2	0.8171
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Lus10041382 [exp]	13.1	0.7965

Compare expression of checked genes

Lus10014172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.