Plant FIBer expression Database

Lus10014173 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09750 40 / 0.0001 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020099
[exp]
111 / 3e-30 AT5G10770 149 / 4e-40 Eukaryotic aspartyl protease family protein (.1)
Lus10000265
[exp]
84 / 5e-20 AT5G10770 173 / 3e-49 Eukaryotic aspartyl protease family protein (.1)
Lus10026905
[exp]
69 / 8e-16 AT5G10760 79 / 7e-18 Eukaryotic aspartyl protease family protein (.1)
Lus10024098
[exp]
45 / 2e-06 AT1G79720 399 / 4e-136 Eukaryotic aspartyl protease family protein (.1)
Lus10041621
[exp]
45 / 3e-06 AT1G79720 510 / 1e-178 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G185175
[exp]
44 / 4e-06 AT1G79720 523 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.001G041700
[exp]
42 / 4e-05 AT1G79720 521 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10014173 pacid=23152875 polypeptide=Lus10014173 locus=Lus10014173.g ID=Lus10014173.BGIv1.0 annot-version=v1.0
ATGTCGCTCAAGAACACCACTAAACCCACCGCCACCACCCAAGGTATGCCCAGCACTGACGAGATGAAATGGATAGAGAAAAGAAACGGAGACGCCACTA
AACCCACCAGACTCGTCACCAATACCGATAACCCAGCTATGTACTTCGTCAATTTCATCGGAATCACCATCGGAGACTTGGTAATTTCATCTCCGTCGTC
GTCGGCGGCGATCGACTCGGGGACCAAAATCAGCCGATTCTCGCCGGAGGTGTATGAAGGCGTCAAAGCAGAGTTCAAGAAATGGATGTCAAATTATAAG
AATGCTGGGAAATTAGATAATTTGGACAGATTTGAAACTCCGTGA
AA sequence
>Lus10014173 pacid=23152875 polypeptide=Lus10014173 locus=Lus10014173.g ID=Lus10014173.BGIv1.0 annot-version=v1.0
MSLKNTTKPTATTQGMPSTDEMKWIEKRNGDATKPTRLVTNTDNPAMYFVNFIGITIGDLVISSPSSSAAIDSGTKISRFSPEVYEGVKAEFKKWMSNYK
NAGKLDNLDRFETP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09750 Eukaryotic aspartyl protease f... Lus10014173
[exp]
0 1
AT2G22120 RING/FYVE/PHD zinc finger supe... Lus10014172
[exp]
1.4 0.8686
AT2G40820 unknown protein Lus10038998
[exp]
1.4 0.9071
AT3G48750 CDKA1, CDC2A, C... cell division control 2 (.1) Lus10038755
[exp]
3.0 0.8583
AT4G12110 ATSMO1-1, SMO1-... sterol-4alpha-methyl oxidase 1... Lus10024555
[exp]
7.3 0.8146
AT3G54030 Protein kinase protein with te... Lus10021112
[exp]
8.0 0.8324
AT2G23140 RING/U-box superfamily protein... Lus10022919
[exp]
11.4 0.8189
AT1G69160 unknown protein Lus10019172
[exp]
13.0 0.8066
AT1G01900 SBTI1.1, ATSBT1... subtilase family protein (.1) Lus10041382
[exp]
15.3 0.7972
AT2G40820 unknown protein Lus10027293
[exp]
15.4 0.8068
AT3G50780 unknown protein Lus10022484
[exp]
17.5 0.7892

Lus10014173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.