Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36110 82 / 5e-19 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT5G36140 79 / 5e-18 CYP716A2 "cytochrome P450, family 716, subfamily A, polypeptide 2", cytochrome P450, family 716, subfamily A, polypeptide 2 (.1) AT4G19230 45 / 6e-06 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT5G14400 39 / 0.0005 CYP724A1 "cytochrome P450, family 724, subfamily A, polypeptide 1", cytochrome P450, family 724, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021725 [exp] 49 / 2e-07 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10042652 [exp] 49 / 3e-07 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10034768 [exp] 46 / 3e-06 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10033308 [exp] 45 / 6e-06 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10033105 [exp] 45 / 8e-06 AT1G05160 305 / 2e-98 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Lus10018898 [exp] 43 / 3e-05 AT5G45340 301 / 3e-97 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10036671 [exp] 43 / 3e-05 AT1G05160 284 / 1e-90 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Lus10028594 [exp] 43 / 3e-05 AT5G45340 299 / 1e-96 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10032211 [exp] 39 / 0.0006 AT4G12320 432 / 2e-147 "cytochrome P450, family 706, subfamily A, polypeptide 6", cytochrome P450, family 706, subfamily A, polypeptide 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G149300 [exp] 112 / 5e-30 AT5G36110 585 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.006G085500 [exp] 108 / 1e-28 AT5G36110 573 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.007G002400 [exp] 105 / 2e-27 AT5G36110 585 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G134000 [exp] 101 / 6e-26 AT5G36110 559 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G133901 [exp] 99 / 6e-25 AT5G36110 526 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G134300 [exp] 97 / 2e-24 AT5G36110 526 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G134700 [exp] 91 / 3e-22 AT5G36110 474 / 7e-165 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106200 [exp] 81 / 2e-18 AT5G36110 492 / 2e-171 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.001G003100 [exp] 69 / 2e-14 AT5G36110 424 / 2e-145 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G078600 [exp] 69 / 2e-14 AT5G36110 476 / 2e-165 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10014175 pacid=23152862 polypeptide=Lus10014175 locus=Lus10014175.g ID=Lus10014175.BGIv1.0 annot-version=v1.0 ATGGGGATTATTAAGGAGAGGAAAGCCGAGTTGGCTCAAGGGAAGAACTCTAGTAAAGATATTTTGTCGTTTATGTTGACCGCCGTTGACGACAGTGGAA AGTATATGACCGAGATGGATATTGCCGACAAGATTCTCGGACTTCCCATCGGCGGCCACGATACGGCTAGTAGCACGTGTAGTTTCATCGTCAAGTTTCT AGCTGAGCTGCCTCATGTATATGATCGAGTTTACCAAGAATGCTACAATATGGGGAGGATGAAAAAACCGCGCCCATTTGGCTACCCGGAACGTGTGCGA TTGTACATAAGGTTAATCTCTTCGAGCAAATTGCCGGTCTGGCAGCATTCGTCGTGTAATTTTGAGATTCGATACGTTTGTAGCCCGTCTAGCTGGACCA GACCAGAATGGATGAGCTCCTAG
AA sequence Show only first row Show all	>Lus10014175 pacid=23152862 polypeptide=Lus10014175 locus=Lus10014175.g ID=Lus10014175.BGIv1.0 annot-version=v1.0 MGIIKERKAELAQGKNSSKDILSFMLTAVDDSGKYMTEMDIADKILGLPIGGHDTASSTCSFIVKFLAELPHVYDRVYQECYNMGRMKKPRPFGYPERVR LYIRLISSSKLPVWQHSSCNFEIRYVCSPSSWTRPEWMSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Lus10014175 [exp]	0	1
AT2G02000		GAD3	glutamate decarboxylase 3 (.1)		Lus10009116 [exp]	1.0	0.9254
AT4G38840			SAUR-like auxin-responsive pro...		Lus10032173 [exp]	1.7	0.9054
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10028397 [exp]	3.2	0.9120
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10032328 [exp]	4.0	0.8850
					Lus10016852 [exp]	4.9	0.8170
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	5.5	0.8902
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10016715 [exp]	6.6	0.8921
AT1G76140			Prolyl oligopeptidase family p...		Lus10034558 [exp]	7.0	0.8889
AT1G53710			Calcineurin-like metallo-phosp...		Lus10042936 [exp]	8.4	0.8354
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10017004 [exp]	8.5	0.8276

Compare expression of checked genes

Lus10014175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.