Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08710 193 / 2e-64 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 128 / 9e-39 Thioredoxin superfamily protein (.1) AT2G40790 126 / 6e-38 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G51030 119 / 2e-35 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G19730 104 / 7e-30 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G45145 102 / 4e-29 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G39950 100 / 1e-27 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT5G42980 94 / 1e-25 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G11530 94 / 2e-25 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT3G17880 99 / 3e-25 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022727 [exp] 288 / 4e-102 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10012859 [exp] 139 / 7e-43 AT3G08710 134 / 9e-41 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10030505 [exp] 139 / 1e-42 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10029009 [exp] 136 / 8e-42 AT3G08710 126 / 5e-38 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10029090 [exp] 128 / 1e-38 AT3G08710 114 / 2e-33 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10041799 [exp] 117 / 7e-35 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 113 / 3e-33 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 112 / 8e-33 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 108 / 4e-31 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G110100 [exp] 206 / 8e-70 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 197 / 6e-66 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 155 / 1e-49 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 120 / 6e-36 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 113 / 4e-33 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 115 / 1e-31 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.012G045000 [exp] 114 / 2e-31 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.002G030000 [exp] 105 / 4e-30 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.004G031700 [exp] 99 / 1e-27 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 96 / 3e-26 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10014186 pacid=23152869 polypeptide=Lus10014186 locus=Lus10014186.g ID=Lus10014186.BGIv1.0 annot-version=v1.0 ATGGGAGGCTGCTTTGCCAAGAATCAAAAAGATGATGATGATGAATCAGAGCACCCAGTTGAATTTGTTGGTGGAAACGTGAAGATGGTTCCTACTGAAG AGAGTTGGAAAGAGCATCTATCAGAAGCAAGCAGGGATGGAAAAACGATAGTCGTGAACTTTAGTGCATCGTGGTGCGGTCCTTGCAGAATGATTGCCCC GTTCTACACTGAGTTGTCCGAGAAGTATCCATCTCTAGTGTTTCTGGCAATCGATGTCGACGAACTAACGGAACTGAGCACATCATGGGAGATAAAGGCG ACGCCGACGTTCTTCTTTCTGAGAAATGGGAAGCAAGTGGACAAGCTAGTCGGAGCCAACAGGCCGGAGCTGCAGAAGAAGATAACAGCAGCTGCTGATT CTGCCACCGAAGCCGGTCATTGTGAATGA
AA sequence Show only first row Show all	>Lus10014186 pacid=23152869 polypeptide=Lus10014186 locus=Lus10014186.g ID=Lus10014186.BGIv1.0 annot-version=v1.0 MGGCFAKNQKDDDDESEHPVEFVGGNVKMVPTEESWKEHLSEASRDGKTIVVNFSASWCGPCRMIAPFYTELSEKYPSLVFLAIDVDELTELSTSWEIKA TPTFFFLRNGKQVDKLVGANRPELQKKITAAADSATEAGHCE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10014186 [exp]	0	1
AT2G42780			unknown protein		Lus10031380 [exp]	1.4	0.8954
AT2G25310			Protein of unknown function (D...		Lus10001955 [exp]	2.0	0.9018
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10025201 [exp]	2.2	0.8819
AT3G12770		MEF22	mitochondrial editing factor ...		Lus10024876 [exp]	2.8	0.8691
AT1G60940		SNRK2-10, SNRK2...	SNF1-RELATED KINASE 2B, SUCROS...		Lus10001367 [exp]	7.3	0.8865
AT4G27650		PEL1	PELOTA, Eukaryotic release fac...		Lus10009553 [exp]	8.2	0.8521
AT5G50430		UBC33	ubiquitin-conjugating enzyme 3...		Lus10003932 [exp]	9.8	0.8786
AT5G47540			Mo25 family protein (.1)		Lus10017565 [exp]	11.4	0.8608
AT1G04555			unknown protein		Lus10023715 [exp]	11.7	0.8852
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Lus10005749 [exp]	13.2	0.8439

Compare expression of checked genes

Lus10014186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.