Lus10014187 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 303 / 5e-108 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G41700 300 / 7e-107 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT4G27960 300 / 9e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G53300 299 / 3e-106 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT3G08690 293 / 4e-104 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 281 / 5e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 278 / 7e-98 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 254 / 2e-88 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 167 / 1e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 152 / 5e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022726 308 / 1e-109 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 302 / 3e-107 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 301 / 7e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 301 / 7e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 299 / 5e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 299 / 5e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 296 / 7e-105 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 293 / 6e-104 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10027846 288 / 1e-101 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G110200 303 / 7e-108 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 301 / 3e-107 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.016G138900 301 / 3e-107 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 301 / 6e-107 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.001G094900 300 / 1e-106 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 298 / 4e-106 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 298 / 4e-106 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.011G168200 292 / 1e-103 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 290 / 7e-103 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 289 / 2e-102 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10014187 pacid=23152851 polypeptide=Lus10014187 locus=Lus10014187.g ID=Lus10014187.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAGCGTATCTTGAAGGAACTCAAGGATCTCCAGAAGGATCCTCCCAGCTCCTGCAGCGCAGGCCCTGTGGCGGAGGACATGTTTCACTGGC
AAGCAACGATTATGGGTCCTTCAGATAGTCCCTATTCTGGAGGTGTTTTCCTGGTTACGATCCACTTTCCTCCGGATTATCCTTTCAAGCCACCCAAGGT
AGCATTTAGGACCAAGGTCTTCCACCCTAATGTCAACAGCAATGGAAGCATTTGTCTTGATATCCTGAAAGAGCAGTGGAGTCCAGCTCTTACGATCTCA
AAGGTACTGCTCTCGATTTGCTCCTTGTTGACGGATCCCAATCCCGATGACCCTTTGGTGCCAGAGATAGCACACATGTACAAGGTCGACCGCTCCAAGT
ACGAGGCTACTGCACGCAGCTGGACCCAGAAGTATGCCATGGGATGA
AA sequence
>Lus10014187 pacid=23152851 polypeptide=Lus10014187 locus=Lus10014187.g ID=Lus10014187.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPSSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKVDRSKYEATARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10014187 0 1
AT3G07580 unknown protein Lus10016076 2.8 0.9652
AT5G08560 transducin family protein / WD... Lus10001045 3.0 0.9573
AT2G23450 Protein kinase superfamily pro... Lus10032741 3.7 0.9662
AT3G51730 saposin B domain-containing pr... Lus10025248 5.2 0.9621
AT4G27130 Translation initiation factor ... Lus10027181 5.3 0.9547
AT3G52220 unknown protein Lus10038762 5.7 0.9545
AT5G23090 CCAAT NF-YB13 "nuclear factor Y, subunit B13... Lus10038952 6.7 0.9583
AT4G37880 LisH/CRA/RING-U-box domains-co... Lus10019837 7.2 0.9552
AT1G11020 RING/FYVE/PHD zinc finger supe... Lus10033053 11.9 0.9440
AT4G32440 Plant Tudor-like RNA-binding p... Lus10024835 12.6 0.9573

Lus10014187 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.