Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44150 50 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011074 [exp] 144 / 1e-45 AT5G44150 84 / 1e-19 unknown protein Lus10038027 [exp] 143 / 3e-44 AT5G44150 123 / 2e-33 unknown protein Lus10018632 [exp] 125 / 6e-36 AT5G44150 202 / 6e-62 unknown protein Lus10039868 [exp] 121 / 2e-34 AT5G44150 201 / 2e-61 unknown protein Lus10005598 [exp] 108 / 4e-31 AT5G44150 124 / 2e-34 unknown protein Lus10035461 [exp] 0 / 1 AT5G44150 91 / 1e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G017200 [exp] 45 / 7e-07 AT5G44150 137 / 2e-36 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014193 pacid=23152940 polypeptide=Lus10014193 locus=Lus10014193.g ID=Lus10014193.BGIv1.0 annot-version=v1.0 ATGGACGCCAAATCACCGACGAAGTCCAAGCGAGTTCACTCTCTAGACCACAACAAGAAGCCACACCCGTCTCGTAAACCAACCGGTTCAGCTACCGCAG GCAGTGAAGATGGTGGAATCGCAAGTAAATCGTCTGAAAAGCCGGTTAAGGATCAAAAACAAGCTGCCTCGCTCGCTTTGCCGTCGAATTCCGATCGTTA TGAGGAAGAGTTTGATTCAGATTCGGCGAAAATGTCAGTTAAGACCTCCGATGTAGCGTTTTCGAATTCTGATTGTCATGGATTTTGA
AA sequence Show only first row Show all	>Lus10014193 pacid=23152940 polypeptide=Lus10014193 locus=Lus10014193.g ID=Lus10014193.BGIv1.0 annot-version=v1.0 MDAKSPTKSKRVHSLDHNKKPHPSRKPTGSATAGSEDGGIASKSSEKPVKDQKQAASLALPSNSDRYEEEFDSDSAKMSVKTSDVAFSNSDCHGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44150			unknown protein		Lus10014193 [exp]	0	1
					Lus10000914 [exp]	6.5	0.6540
AT2G39530			Uncharacterised protein family...		Lus10031305 [exp]	9.2	0.6540
AT5G44005			unknown protein		Lus10008219 [exp]	13.1	0.6522
AT5G59700			Protein kinase superfamily pro...		Lus10023324 [exp]	13.7	0.6273
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10036966 [exp]	14.0	0.6449
AT4G25350		SHB1	SHORT HYPOCOTYL UNDER BLUE1, E...		Lus10037146 [exp]	18.0	0.6373
					Lus10030519 [exp]	20.7	0.5361
					Lus10003607 [exp]	27.3	0.6417
AT1G15000		SCPL50	serine carboxypeptidase-like 5...		Lus10013446 [exp]	39.3	0.5339
AT3G06240			F-box family protein (.1)		Lus10007040 [exp]	42.7	0.4944

Compare expression of checked genes

Lus10014193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.