Lus10014198 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52730 95 / 9e-28 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022716 122 / 9e-39 AT3G52730 94 / 1e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10021364 115 / 8e-36 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10017043 115 / 8e-36 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G188700 92 / 1e-26 AT3G52730 122 / 2e-38 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Potri.009G149300 92 / 2e-26 AT3G52730 117 / 2e-36 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Representative CDS sequence
>Lus10014198 pacid=23152941 polypeptide=Lus10014198 locus=Lus10014198.g ID=Lus10014198.BGIv1.0 annot-version=v1.0
ATGGAGTATGTACCGAGGAGAACTCAAGGTGGCCTTTTCGAAGGCATCTACAAGGTTTTCATGCGCCGTACCTCCGTCTACGCCACCTTCGTCCTCGCCG
GTGCTTTCTTCGGTGAACGGGCCGTGGATTATGGTGTTCATAAGCTGTGGGAACACAACAATGTTGGGGTAATTCTCTATTCTTTGCTTATTTGTGACAG
CTGA
AA sequence
>Lus10014198 pacid=23152941 polypeptide=Lus10014198 locus=Lus10014198.g ID=Lus10014198.BGIv1.0 annot-version=v1.0
MEYVPRRTQGGLFEGIYKVFMRRTSVYATFVLAGAFFGERAVDYGVHKLWEHNNVGVILYSLLICDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52730 ubiquinol-cytochrome C reducta... Lus10014198 0 1
AT5G07960 unknown protein Lus10021623 1.0 0.9257
AT1G05205 unknown protein Lus10039669 2.8 0.9179
AT3G05070 unknown protein Lus10026367 3.5 0.9042
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10023131 5.5 0.8698
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10041194 6.6 0.8957
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Lus10037823 8.2 0.8620
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10037416 8.7 0.8924
AT1G11240 unknown protein Lus10011247 9.5 0.8830
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10011491 10.6 0.8637
AT1G67785 unknown protein Lus10042077 11.2 0.8601

Lus10014198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.