Lus10014202 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15770 206 / 2e-69 ATGNA1 glucose-6-phosphate acetyltransferase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022713 306 / 2e-108 AT5G15770 206 / 4e-69 glucose-6-phosphate acetyltransferase 1 (.1)
Lus10029099 43 / 3e-05 AT1G26220 239 / 6e-81 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G086400 244 / 7e-84 AT5G15770 219 / 9e-74 glucose-6-phosphate acetyltransferase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10014202 pacid=23152859 polypeptide=Lus10014202 locus=Lus10014202.g ID=Lus10014202.BGIv1.0 annot-version=v1.0
ATGCAGGATGATAACTCATCCATTACCAATCAGAGCTTCCAAGTACGCAAATTGCAGATATCAGACAAAACCAAAGGCTTCATCGAGCTCTTACAGCAGC
TCAGCGCCTGCGATTCTGTATCGGACAAGGATTTCGAGGAACGGTTCCACGAGCTGACCTCCTACGGGGACGACCATCTCATCTGTGTAATCGAAGATGA
CAAAACGGGGAAGATCGTAGCCACGGGCTGTGTGTTCGTGGAGAAGAAGTTCTTGAGGAACTGCGGCAAAGTAGGGCACATTGAGGATGTCGTCGTCGAT
TCCAGCGCCAGAGGGTTGCACCTGGGGAAGAAAATCGTGGATTTCCTCACGGATCACGCTCGTTCCAATGGTTGCTACAAGGTGATCCTGGATTGCAGTG
ATGGTAACAAGTCGTTCTATGAGAAGTGTGGGTTCAAGCAGAAGGAGATCCAGATGGTTCAATATTTCGTCTGA
AA sequence
>Lus10014202 pacid=23152859 polypeptide=Lus10014202 locus=Lus10014202.g ID=Lus10014202.BGIv1.0 annot-version=v1.0
MQDDNSSITNQSFQVRKLQISDKTKGFIELLQQLSACDSVSDKDFEERFHELTSYGDDHLICVIEDDKTGKIVATGCVFVEKKFLRNCGKVGHIEDVVVD
SSARGLHLGKKIVDFLTDHARSNGCYKVILDCSDGNKSFYEKCGFKQKEIQMVQYFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15770 ATGNA1 glucose-6-phosphate acetyltran... Lus10014202 0 1
AT2G20140 RPT2b regulatory particle AAA-ATPase... Lus10022834 43.6 0.6468
AT4G30010 unknown protein Lus10001623 74.5 0.5953
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Lus10010475 99.0 0.6259
AT1G79800 AtENODL7 early nodulin-like protein 7 (... Lus10024846 104.3 0.5657
Lus10007551 130.9 0.5982
AT5G18110 NCBP novel cap-binding protein (.1) Lus10020282 226.0 0.5798

Lus10014202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.