Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08080 96 / 6e-25 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) AT1G08065 94 / 1e-24 ATACA5, ACA5 alpha carbonic anhydrase 5 (.1) AT2G28210 89 / 7e-23 ATACA2 alpha carbonic anhydrase 2 (.1) AT5G56330 81 / 3e-19 ATACA8, ACA8 A. THALIANA ALPHA CARBONIC ANHYDRASE 8, alpha carbonic anhydrase 8 (.1) AT3G52720 79 / 5e-19 CAH1, ATACA1, ACA1 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) AT4G21000 79 / 1e-18 ATACA6, ACA6 A. THALIANA ALPHA CARBONIC ANHYDRASE 6, alpha carbonic anhydrase 6 (.1) AT4G20990 79 / 1e-18 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) AT5G04180 71 / 7e-16 ATACA3, ACA3 alpha carbonic anhydrase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022710 [exp] 198 / 8e-65 AT3G52720 218 / 4e-70 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Lus10017033 [exp] 124 / 1e-35 AT3G52720 231 / 4e-75 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Lus10021356 [exp] 123 / 2e-35 AT3G52720 231 / 6e-75 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Lus10018017 [exp] 97 / 5e-25 AT4G20990 240 / 4e-78 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10042030 [exp] 90 / 3e-22 AT4G20990 313 / 9e-107 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10042013 [exp] 88 / 9e-22 AT4G20990 224 / 2e-72 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10016105 [exp] 84 / 2e-20 AT1G08080 333 / 1e-115 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10014412 [exp] 82 / 7e-20 AT1G08080 277 / 2e-93 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10021454 [exp] 82 / 9e-20 AT1G08080 300 / 1e-102 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G079600 [exp] 92 / 2e-23 AT3G52720 271 / 8e-91 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Potri.006G212900 [exp] 91 / 3e-23 AT3G52720 261 / 5e-87 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Potri.009G010200 [exp] 89 / 2e-22 AT1G08080 342 / 3e-119 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Potri.006G121900 [exp] 86 / 4e-21 AT1G08080 289 / 4e-98 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Potri.006G047500 [exp] 84 / 1e-20 AT4G20990 276 / 5e-93 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.006G047400 [exp] 84 / 1e-20 AT4G20990 289 / 4e-98 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.016G043700 [exp] 84 / 2e-20 AT4G20990 306 / 4e-105 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.004G212800 [exp] 83 / 4e-20 AT1G08080 347 / 3e-121 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00194 [flax] [poplar] Carb_anhydrase Eukaryotic-type carbonic anhydrase
Representative CDS sequence Show only first row Show all	>Lus10014205 pacid=23152953 polypeptide=Lus10014205 locus=Lus10014205.g ID=Lus10014205.BGIv1.0 annot-version=v1.0 ATGAATGTATTTATCTATGTTTTATTGTCATTTTGCTTGCCATTGCTTGCCGTTACCTATCGTTTCAAGAGTGGGCCAAAAGGGCCGGAAAATTGGGTGA GTTTGCACCCGTTGTTCGAGAAATGTGGATCGGGAAAATCTGAGTCACCAATTGACATCAGTGGGAAGGATGTTAAAAACGAAAAGCTTGAGCCATTGGA GGGCGATTACAAACCTGTCGAGGCCACTCTTGTTAATATCGGCCACAACATCATCATTCATTTTGATGATCCGGAAGCCGGAGAGTTGAAGATAGATGGG AAAACTTACAAGCTCAAGCAAATCCATTGGCATACTCCTTCCGAGCACACCTTCAATGCCACAGTGTAA
AA sequence Show only first row Show all	>Lus10014205 pacid=23152953 polypeptide=Lus10014205 locus=Lus10014205.g ID=Lus10014205.BGIv1.0 annot-version=v1.0 MNVFIYVLLSFCLPLLAVTYRFKSGPKGPENWVSLHPLFEKCGSGKSESPIDISGKDVKNEKLEPLEGDYKPVEATLVNIGHNIIIHFDDPEAGELKIDG KTYKLKQIHWHTPSEHTFNATV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10014205 [exp]	0	1

Compare expression of checked genes

Lus10014205 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.