Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18590 152 / 3e-49 Nucleic acid-binding, OB-fold-like protein (.1) AT3G52630 149 / 3e-48 Nucleic acid-binding, OB-fold-like protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014210 [exp] 218 / 4e-75 AT4G18590 143 / 2e-45 Nucleic acid-binding, OB-fold-like protein (.1) Lus10022705 [exp] 217 / 6e-75 AT4G18590 147 / 3e-47 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211900 [exp] 180 / 2e-60 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) Potri.006G212100 [exp] 180 / 2e-60 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) Potri.010G239200 [exp] 135 / 1e-42 AT4G18590 135 / 1e-42 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF08661 [flax] [poplar] Rep_fac-A_3 Replication factor A protein 3
Representative CDS sequence Show only first row Show all	>Lus10014209 pacid=23152911 polypeptide=Lus10014209 locus=Lus10014209.g ID=Lus10014209.BGIv1.0 annot-version=v1.0 ATGGACACATCGAACCCTGCGATTTTCGTCAACGGCGCCCTGCTGCCGATGCATCTGAGGAAGAGAGTCAGGACTGTGATCCAAGTCATTCAGTCCGAGC TCGGATCAGTCGTCGGGAAAACCACAGATGAGCAACAGATAGTAATCAAGGGCTCCCCGCCGCCTGAATCCCAACCTCTCACTACCTTCGTTGAAGTCGT CGGCATTGCAGACTCTGAGAAGTCCATCCAGGCTGAGATATGGACCAACTTCGGCAATGCAGCCGACGCCTACTCCTTCAATCAGCTTTGCCAGCTTGCA AATGGTGAATACAAACACTTGTTCCTCTGA
AA sequence Show only first row Show all	>Lus10014209 pacid=23152911 polypeptide=Lus10014209 locus=Lus10014209.g ID=Lus10014209.BGIv1.0 annot-version=v1.0 MDTSNPAIFVNGALLPMHLRKRVRTVIQVIQSELGSVVGKTTDEQQIVIKGSPPPESQPLTTFVEVVGIADSEKSIQAEIWTNFGNAADAYSFNQLCQLA NGEYKHLFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10014209 [exp]	0	1
AT5G52220			unknown protein		Lus10038870 [exp]	1.4	0.9245
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10018191 [exp]	5.3	0.9145
AT4G10630			Glutaredoxin family protein (....		Lus10008270 [exp]	9.2	0.9095
AT5G43250	CCAAT	NF-YC13	"nuclear factor Y, subunit C13...		Lus10030657 [exp]	9.5	0.9032
AT3G63200		PLP9, PLAIIIB ,...	PATATIN-like protein 9 (.1)		Lus10042584 [exp]	9.8	0.8967
AT4G28310			unknown protein		Lus10018597 [exp]	10.8	0.8928
AT5G66750		CHR01, CHA1, SO...	SOMNIFEROUS 1, DECREASED DNA M...		Lus10041735 [exp]	13.0	0.9133
AT3G03590			SWIB/MDM2 domain superfamily p...		Lus10005667 [exp]	13.9	0.8885
AT3G44750		HDT1, HDA3, ATH...	HISTONE DEACETYLASE 2A, histon...		Lus10009390 [exp]	15.0	0.8859
AT5G58930			Protein of unknown function (D...		Lus10018206 [exp]	15.7	0.9002

Compare expression of checked genes

Lus10014209 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.