Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18590 143 / 1e-45 Nucleic acid-binding, OB-fold-like protein (.1) AT3G52630 141 / 1e-44 Nucleic acid-binding, OB-fold-like protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014209 [exp] 219 / 2e-75 AT4G18590 151 / 4e-49 Nucleic acid-binding, OB-fold-like protein (.1) Lus10022705 [exp] 211 / 2e-72 AT4G18590 147 / 3e-47 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211900 [exp] 171 / 1e-56 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) Potri.006G212100 [exp] 171 / 1e-56 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) Potri.010G239200 [exp] 130 / 2e-40 AT4G18590 135 / 1e-42 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF08661 [flax] [poplar] Rep_fac-A_3 Replication factor A protein 3
Representative CDS sequence Show only first row Show all	>Lus10014210 pacid=23152918 polypeptide=Lus10014210 locus=Lus10014210.g ID=Lus10014210.BGIv1.0 annot-version=v1.0 ATGGACACATCGAACCCTGCGATTTTCGTCAACGGCGCCCTGCTGCCGATGCATCTGAGGAAGAGAGTCAGGACTGTGATCCAAGTCATTCAGTCCGAGC TCGGATCAGTCGTCGGGAAAACCACAGATGAGCAACAGATAGTAATCAAGGGCTCCCCGCCGCCTGAATCCCAACCTCTCACTACCTTCGTTGAAGTCGT CGGCATTGCAGACTCTGAGAAGTCCATCCAGGCTGAGATATGGACCAACTTCGGCAATGCAGCCGACGCCTACTCCTTCAATCAGCTTTGCCAGCTTGCA AATGGTGAATACAAACCCGCCGTGGCCGGTGCTGCGTTTGGCATCGCCAAGATGTTGAGAGAGAGGCGTTAA
AA sequence Show only first row Show all	>Lus10014210 pacid=23152918 polypeptide=Lus10014210 locus=Lus10014210.g ID=Lus10014210.BGIv1.0 annot-version=v1.0 MDTSNPAIFVNGALLPMHLRKRVRTVIQVIQSELGSVVGKTTDEQQIVIKGSPPPESQPLTTFVEVVGIADSEKSIQAEIWTNFGNAADAYSFNQLCQLA NGEYKPAVAGAAFGIAKMLRERR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10014210 [exp]	0	1
AT5G41970			Metal-dependent protein hydrol...		Lus10000877 [exp]	5.0	0.8796
AT4G25340		ATFKBP53	FK506 BINDING PROTEIN 53 (.1.2...		Lus10015029 [exp]	6.0	0.8600
AT4G28310			unknown protein		Lus10018597 [exp]	7.6	0.8777
AT3G01790			Ribosomal protein L13 family p...		Lus10014597 [exp]	8.1	0.8510
AT4G28310			unknown protein		Lus10033688 [exp]	10.7	0.8203
AT3G05130			unknown protein		Lus10002255 [exp]	14.4	0.8359
AT2G37510			RNA-binding (RRM/RBD/RNP motif...		Lus10023758 [exp]	15.6	0.8272
AT2G37020			Translin family protein (.1.2)		Lus10029829 [exp]	16.6	0.8405
AT3G02820			zinc knuckle (CCHC-type) famil...		Lus10030564 [exp]	20.8	0.8643
AT1G48830			Ribosomal protein S7e family p...		Lus10017497 [exp]	21.3	0.8402

Compare expression of checked genes

Lus10014210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.