Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52570 130 / 1e-38 alpha/beta-Hydrolases superfamily protein (.1) AT4G10030 46 / 3e-07 alpha/beta-Hydrolases superfamily protein (.1) AT4G10050 39 / 8e-05 esterase/lipase/thioesterase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022689 [exp] 159 / 1e-51 AT3G52570 182 / 5e-57 alpha/beta-Hydrolases superfamily protein (.1) Lus10016992 [exp] 147 / 8e-44 AT3G52570 433 / 1e-150 alpha/beta-Hydrolases superfamily protein (.1) Lus10021315 [exp] 116 / 3e-32 AT3G52570 397 / 2e-136 alpha/beta-Hydrolases superfamily protein (.1) Lus10041047 [exp] 44 / 3e-06 AT4G10030 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G076601 [exp] 127 / 8e-40 AT3G52570 181 / 1e-57 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G077066 [exp] 128 / 2e-39 AT3G52570 173 / 1e-53 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G076550 [exp] 128 / 1e-38 AT3G52570 327 / 9e-113 alpha/beta-Hydrolases superfamily protein (.1) Potri.019G074600 [exp] 49 / 2e-08 AT4G10030 485 / 5e-172 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014222 pacid=23152930 polypeptide=Lus10014222 locus=Lus10014222.g ID=Lus10014222.BGIv1.0 annot-version=v1.0 ATGGTGCTTGTGGATCTCAGGAACCACGGGAATTCTGCAAAGATGGAAGGTCTTGAGCCGCCTCACGACATGTCTAGTGCGGCGAATGATTTGGCGAATT TGGTTAAAGCTCGAGGTTGGGATTGGCCTGATGTTGTTATGGGCCACTCAATGGGAGGTAAAGTCGCGCTGCAATTCTCGGAGAGCTGCGCTCGTGGTGA CTATGGCGATTCTGCGGCATTGCCGAAGCAGGTATTCTAG
AA sequence Show only first row Show all	>Lus10014222 pacid=23152930 polypeptide=Lus10014222 locus=Lus10014222.g ID=Lus10014222.BGIv1.0 annot-version=v1.0 MVLVDLRNHGNSAKMEGLEPPHDMSSAANDLANLVKARGWDWPDVVMGHSMGGKVALQFSESCARGDYGDSAALPKQVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10014222 [exp]	0	1
AT2G37300		ABCI16	ATP-binding cassette I16, unkn...		Lus10025272 [exp]	1.0	0.8989
AT2G23140			RING/U-box superfamily protein...		Lus10024899 [exp]	3.0	0.8448
AT5G57280		RID2	root initiation defective 2, S...		Lus10020005 [exp]	3.2	0.8194
AT5G63420	Trihelix	EMB2746	embryo defective 2746, RNA-met...		Lus10016758 [exp]	11.0	0.8348
AT1G73970			unknown protein		Lus10000648 [exp]	13.9	0.8461
AT3G48820			Glycosyltransferase family 29 ...		Lus10043193 [exp]	15.0	0.7954
AT5G43270	SBP	SPL2	squamosa promoter binding prot...		Lus10040595 [exp]	16.9	0.8019
AT5G02440			unknown protein		Lus10025345 [exp]	23.5	0.7984
AT5G63420	Trihelix	EMB2746	embryo defective 2746, RNA-met...		Lus10022454 [exp]	24.2	0.8318
AT1G54385			ARM repeat superfamily protein...		Lus10002627 [exp]	24.4	0.8053

Compare expression of checked genes

Lus10014222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.