Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01650 167 / 6e-55 Tautomerase/MIF superfamily protein (.1.2) AT5G57170 119 / 4e-36 Tautomerase/MIF superfamily protein (.1.2) AT3G51660 102 / 2e-29 Tautomerase/MIF superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022681 [exp] 192 / 2e-64 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10012223 [exp] 132 / 3e-41 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2) Lus10012222 [exp] 114 / 8e-34 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1) Lus10033324 [exp] 83 / 4e-21 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 81 / 3e-20 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10000344 [exp] 71 / 2e-17 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) Lus10000345 [exp] 52 / 4e-09 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104500 [exp] 160 / 2e-52 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 157 / 8e-51 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126500 [exp] 154 / 1e-49 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 149 / 6e-48 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 146 / 1e-46 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 132 / 4e-41 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2) Potri.016G127300 [exp] 115 / 2e-34 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104800 [exp] 114 / 4e-34 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G075100 [exp] 114 / 8e-34 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [flax] [poplar] MIF PF01187 [flax] [poplar] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Lus10014233 pacid=23152910 polypeptide=Lus10014233 locus=Lus10014233.g ID=Lus10014233.BGIv1.0 annot-version=v1.0 ATGCCGTGCCTGAACTTGTCGACGAACGTCAGTCTCGAAGGTGTTGATACCTCCGGCATCCTCGCCGAAGCTACCTCCACCGTCGCCAGCATCATCGGAA AACCTCCTTCGTATGTGATGATTGTGTTGAAAGGCTCGATCCCGATTGCATTTGGTGGGACTGAGCAGCCAGCTGCTTATGGTGAGTTGGTCTCCATTGG TGGCCTTAACCCCGACACCAACAAGAAGCTCAGCGCTGGAATCTCCGCCATCCTCGAGACAAAGCTGAACGTCCCCAAGGGGAGATTCTTCCTCAAGGTT CCGACTTCGGATGGAATGGTTCGACCTTCTGATATCCAGTCCTTTTGGCTGAATTGCTTCAGACTTTGA
AA sequence Show only first row Show all	>Lus10014233 pacid=23152910 polypeptide=Lus10014233 locus=Lus10014233.g ID=Lus10014233.BGIv1.0 annot-version=v1.0 MPCLNLSTNVSLEGVDTSGILAEATSTVASIIGKPPSYVMIVLKGSIPIAFGGTEQPAAYGELVSIGGLNPDTNKKLSAGISAILETKLNVPKGRFFLKV PTSDGMVRPSDIQSFWLNCFRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10014233 [exp]	0	1
AT4G26500		SUFE1, EMB1374,...	SULFUR E 1, MBRYO DEFECTIVE 13...		Lus10032905 [exp]	2.4	0.8520
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10032033 [exp]	6.3	0.8444
AT4G28210		EMB1923	embryo defective 1923 (.1)		Lus10031620 [exp]	7.3	0.8118
AT4G12340			copper ion binding (.1)		Lus10032225 [exp]	9.4	0.8242
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10031423 [exp]	12.4	0.8107
AT1G14060			GCK domain-containing protein ...		Lus10037148 [exp]	12.8	0.7520
AT5G39600			unknown protein		Lus10033166 [exp]	13.0	0.7778
AT1G51450		ASH2R, TRO	ARABIDOPSIS Ash2 RELATIVE, TRA...		Lus10027355 [exp]	15.0	0.8044
AT2G37400			Tetratricopeptide repeat (TPR)...		Lus10024433 [exp]	15.8	0.8241
AT4G28730		GrxC5	glutaredoxin C5, Glutaredoxin ...		Lus10011915 [exp]	16.5	0.8207

Compare expression of checked genes

Lus10014233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.