Lus10014234 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 141 / 2e-42 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT5G01640 123 / 2e-35 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G05380 116 / 5e-33 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT3G56110 111 / 6e-31 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT2G40380 110 / 2e-30 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G07110 95 / 2e-24 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT4G00005 73 / 3e-17 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 52 / 1e-08 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G08770 51 / 3e-08 PRA1.E prenylated RAB acceptor 1.E (.1)
AT3G13710 50 / 8e-08 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022680 178 / 1e-57 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 155 / 8e-48 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10012224 147 / 8e-45 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 125 / 7e-36 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 122 / 2e-35 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 115 / 3e-32 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 114 / 6e-32 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 112 / 3e-31 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10042099 75 / 2e-18 AT2G38360 82 / 5e-21 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G074000 127 / 3e-37 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 127 / 3e-37 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 126 / 9e-37 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.016G126400 122 / 2e-35 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.006G104400 115 / 1e-32 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.019G124100 105 / 6e-29 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.002G044000 66 / 7e-14 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 66 / 1e-13 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G219100 66 / 2e-13 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 59 / 4e-11 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10014234 pacid=23152952 polypeptide=Lus10014234 locus=Lus10014234.g ID=Lus10014234.BGIv1.0 annot-version=v1.0
ATGGCTGCCGTCGCCGCTCAATCTCCCCCGATCGTCCCGATCTCCAATTCCCAATCGGCCCCATCCTTAACCACCACCGTCGTCAATCCTTCCTCCTCCT
CCTCGCAGCCGCCCCCCCCCCCTCCCCGCTCCCGCCCCACCAGCCCCCCTCCAATCTCGCTCATGTTCCTCGTCGGCCTCCTCGCGTCCTGGATCTTCCT
CTACCTGTTCCGCCCCGCGGATCAGCCGCTTGTGTTCTTCGGACGGAGCTTCACCGACATGGAGACGCTCGGGATCCTCGTCGTGTTCAGTGTATTTGTC
GTGTTCCTCACCAACGTCGGATCTGTGCTCATCTCGGCGGTGATGCTCGGCTCGGCGGTCGTCTGTGCACATGGATCGTTTAGGATCCCTGAGGATATGT
TCTTGGATGAGCAGGAGCCATCCGCTGCAAGTGGATTCCTCTCGTTCCTTGGTGGTGCTGCGACGAATGTGGCTGCCACGACTGCTGCTCGCGTCTGA
AA sequence
>Lus10014234 pacid=23152952 polypeptide=Lus10014234 locus=Lus10014234.g ID=Lus10014234.BGIv1.0 annot-version=v1.0
MAAVAAQSPPIVPISNSQSAPSLTTTVVNPSSSSSQPPPPPPRSRPTSPPPISLMFLVGLLASWIFLYLFRPADQPLVFFGRSFTDMETLGILVVFSVFV
VFLTNVGSVLISAVMLGSAVVCAHGSFRIPEDMFLDEQEPSAASGFLSFLGGAATNVAATTAARV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10014234 0 1
AT4G01850 AtSAM2, SAM-2, ... S-adenosylmethionine synthetas... Lus10010070 1.0 0.9781
AT1G26570 UGD1, ATUGD1 UDP-glucose dehydrogenase 1 (.... Lus10037096 2.8 0.9754
AT3G29360 UGD2 UDP-glucose dehydrogenase 2, U... Lus10036887 3.0 0.9646
AT1G06780 GAUT6 galacturonosyltransferase 6 (.... Lus10024859 3.2 0.9597
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10005504 4.7 0.9364
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10036886 4.9 0.9587
AT1G14890 Plant invertase/pectin methyle... Lus10037919 5.1 0.9280
AT5G67540 Arabinanase/levansucrase/inver... Lus10019280 5.5 0.9342
AT3G17390 MAT4, SAMS3, MT... S-ADENOSYLMETHIONINE SYNTHETAS... Lus10004522 5.7 0.9525
AT4G08810 SUB1 calcium ion binding (.1) Lus10013761 5.9 0.9557

Lus10014234 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.