Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 249 / 3e-84 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 231 / 4e-77 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 218 / 4e-72 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G26040 187 / 2e-60 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT5G53160 185 / 2e-59 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT1G01360 184 / 3e-59 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G17870 184 / 6e-59 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G27920 179 / 2e-57 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT4G01026 174 / 4e-55 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT1G73000 161 / 6e-50 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022675 [exp] 373 / 4e-132 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 265 / 2e-90 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 212 / 8e-71 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10002861 [exp] 207 / 4e-68 AT2G38310 176 / 7e-56 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 196 / 7e-64 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10029222 [exp] 194 / 5e-63 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 187 / 3e-60 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10014929 [exp] 178 / 4e-56 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 176 / 4e-56 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G125400 [exp] 311 / 1e-108 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 306 / 5e-107 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 233 / 4e-78 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 229 / 1e-76 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.001G142500 [exp] 201 / 1e-65 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.003G091700 [exp] 194 / 5e-63 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.018G054400 [exp] 189 / 6e-61 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.006G230600 [exp] 188 / 8e-61 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.012G000800 [exp] 186 / 5e-60 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 184 / 2e-59 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10014239 pacid=23152927 polypeptide=Lus10014239 locus=Lus10014239.g ID=Lus10014239.BGIv1.0 annot-version=v1.0 ATGCCTTCAAATCCTCCCAAATCCTCACTCCTCCTCCACCGCATCACCGACGCCGCCGCCGCCGCCACGGCGTGCCAGAAGCAGCGTCGGTTTCCGCTTC CCTCCGCCGTCCCGGATGCGGCAGTAGCCCGGTACCACGACCACGCGTTGGGGCCCAACCAGTGCAGCTCCGCCGTTGTGCAGCAGATCGCCGCCCCTAT CTCCACCGTCTGGTCCGTGTTGAGGAGGTTCGATAACCCGCAAGCGTACAAGCACTTCGTCAAGAGCTGCCACGTCATCCTCGGCACCGGCGACGTCGGG TCCCTCCGTGAGGTCCACGTCATCTCGGGCCTTCCGGCTGCCAACAGCACCGAGAGGCTTGAGATCCTCGACGAGGAGAGACACGTCATCAGCTTCAGCG TCGTGGGTGGGGACCACAGGCTGGCCAATTACCGTTCCGTCACCACGCTACACGGCGGCGGCGGAGAGACGGTGGCGGTAGAGTCTTACGTGGTCGACGT TCCACCGGGGAACACGAAGGAGGACACATGCGTGTTCGTCGACACGATCGTCCAGTGCAACCTTCAGTCGCTGGCGCAGATCGCGGAAAATTCAGCTCGC CGCAGTAAAGCAGTGTCGCCGTCGACGGCTCCGACCAAATCGTGA
AA sequence Show only first row Show all	>Lus10014239 pacid=23152927 polypeptide=Lus10014239 locus=Lus10014239.g ID=Lus10014239.BGIv1.0 annot-version=v1.0 MPSNPPKSSLLLHRITDAAAAATACQKQRRFPLPSAVPDAAVARYHDHALGPNQCSSAVVQQIAAPISTVWSVLRRFDNPQAYKHFVKSCHVILGTGDVG SLREVHVISGLPAANSTERLEILDEERHVISFSVVGGDHRLANYRSVTTLHGGGGETVAVESYVVDVPPGNTKEDTCVFVDTIVQCNLQSLAQIAENSAR RSKAVSPSTAPTKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10014239 [exp]	0	1
AT2G19580		TET2	tetraspanin2 (.1)		Lus10008563 [exp]	1.4	0.9451
AT5G23100			Protein of unknown function, D...		Lus10009615 [exp]	2.0	0.9320
AT1G70420			Protein of unknown function (D...		Lus10042116 [exp]	2.0	0.9410
AT3G15480			Protein of unknown function (D...		Lus10043091 [exp]	7.1	0.9329
AT4G23496		SP1L5	SPIRAL1-like5 (.1)		Lus10024667 [exp]	7.9	0.9238
AT3G28917	ZF_HD	MIF2	mini zinc finger 2 (.1)		Lus10015370 [exp]	10.4	0.9095
AT1G27100			Actin cross-linking protein (....		Lus10037230 [exp]	10.8	0.9038
AT5G35732			unknown protein		Lus10012359 [exp]	12.8	0.8890
AT4G20880			ethylene-responsive nuclear pr...		Lus10023347 [exp]	15.6	0.9040
AT4G10390			Protein kinase superfamily pro...		Lus10013656 [exp]	17.6	0.9028

Compare expression of checked genes

Lus10014239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.