Lus10014246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28650 91 / 2e-21 Leucine-rich repeat transmembrane protein kinase family protein (.1)
AT1G08590 70 / 3e-14 Leucine-rich receptor-like protein kinase family protein (.1)
AT4G20940 63 / 1e-11 Leucine-rich receptor-like protein kinase family protein (.1)
AT2G24130 61 / 4e-11 Leucine-rich receptor-like protein kinase family protein (.1)
AT2G41820 60 / 8e-11 Leucine-rich repeat protein kinase family protein (.1)
AT5G44700 58 / 4e-10 GSO2, EDA23 GASSHO 2, EMBRYO SAC DEVELOPMENT ARREST 23, Leucine-rich repeat transmembrane protein kinase (.1)
AT5G48940 57 / 8e-10 Leucine-rich repeat transmembrane protein kinase family protein (.1)
AT4G20140 57 / 1e-09 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
AT5G65240 56 / 2e-09 Leucine-rich repeat protein kinase family protein (.1.2)
AT1G25320 56 / 2e-09 Leucine-rich repeat protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014243 145 / 3e-43 AT4G28650 268 / 3e-83 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Lus10027951 100 / 2e-24 AT1G08590 1256 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10000814 97 / 1e-23 AT1G08590 1263 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10038544 64 / 5e-12 AT4G20940 1035 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10023260 60 / 1e-10 AT4G20940 704 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10030068 59 / 2e-10 AT5G49290 397 / 3e-124 receptor like protein 56 (.1)
Lus10002579 58 / 2e-10 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1)
Lus10038598 59 / 4e-10 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10014236 58 / 4e-10 AT3G51740 907 / 0.0 inflorescence meristem receptor-like kinase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G256500 110 / 4e-28 AT4G28650 1339 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Potri.019G021700 103 / 5e-26 AT1G08590 1286 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.013G048800 92 / 5e-22 AT1G08590 1306 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.003G107600 62 / 1e-11 AT5G61480 1259 / 0.0 TDIF receptor, PHLOEM INTERCALATED WITH XYLEM, Leucine-rich repeat protein kinase family protein (.1)
Potri.011G163700 62 / 2e-11 AT4G20940 946 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.015G080800 61 / 3e-11 AT5G56040 1019 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2)
Potri.001G126100 61 / 6e-11 AT5G61480 1258 / 0.0 TDIF receptor, PHLOEM INTERCALATED WITH XYLEM, Leucine-rich repeat protein kinase family protein (.1)
Potri.019G099200 61 / 7e-11 AT4G08850 654 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
Potri.019G129400 60 / 1e-10 AT4G08850 708 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
Potri.001G465800 59 / 2e-10 AT4G20940 915 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10014246 pacid=23164719 polypeptide=Lus10014246 locus=Lus10014246.g ID=Lus10014246.BGIv1.0 annot-version=v1.0
ATGGTTTTCACAAATTTATGGGTTTGTTTTAGTTTCACAACCAGTTTTCAGGTTCAGTTCCTGAAACCCTTGGGGATTTGCCTCAGTTGCAGGTCTTGGA
GCTTTGGAACAATTCTTTCTCAGGTTCATTGCCAAGTGACCTGGGCAGGGAATCTCCATTGCAGTGGTAGATGTTTCGTCGAATTCCTTCTCCAGACTGA
TTCCTGCGAGCTTGTGCAATGGTGGCAACCTCACCAAGCTCATACTCTTCAACAATGGCTTCTCCGCCTTGGGAAGCTTCAGAGATTAGAGTTAGCAAAC
AAAAGCCTTACAGGTCAAATCCCTAATGATCTCGGCTCTTCCACGTCTCTTACTTTCATTGATCTTTCAAGAAATGACCTCATATCTTATCTCCCTTCCA
CAATTCTGTCCATCCCCAATCTTCAATCCTTCATGGCCTCGGGAAACAATCTGGAATGCGAAATCCCTGGCCAGTTTCAGGGCTGTCCTGCTCTTTCTGT
TATTGATCTCTCGTCAAACAATTTCTCCGGTACGATTCGTTAA
AA sequence
>Lus10014246 pacid=23164719 polypeptide=Lus10014246 locus=Lus10014246.g ID=Lus10014246.BGIv1.0 annot-version=v1.0
MVFTNLWVCFSFTTSFQVQFLKPLGICLSCRSWSFGTILSQVHCQVTWAGNLHCSGRCFVEFLLQTDSCELVQWWQPHQAHTLQQWLLRLGKLQRLELAN
KSLTGQIPNDLGSSTSLTFIDLSRNDLISYLPSTILSIPNLQSFMASGNNLECEIPGQFQGCPALSVIDLSSNNFSGTIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28650 Leucine-rich repeat transmembr... Lus10014246 0 1
AT5G22450 unknown protein Lus10000530 7.4 1.0000
Lus10003536 9.9 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 12.8 1.0000
Lus10011832 14.3 1.0000
Lus10011078 14.6 1.0000
Lus10022518 15.0 1.0000
Lus10011425 16.3 1.0000
Lus10023589 17.2 1.0000
Lus10028667 19.9 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 20.6 1.0000

Lus10014246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.