Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28703 127 / 2e-39 RmlC-like cupins superfamily protein (.1) AT3G04300 126 / 5e-39 RmlC-like cupins superfamily protein (.1) AT4G10300 121 / 1e-36 RmlC-like cupins superfamily protein (.1) AT4G10280 69 / 7e-16 RmlC-like cupins superfamily protein (.1) AT4G10290 62 / 2e-13 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025947 [exp] 186 / 2e-62 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1) Lus10035659 [exp] 113 / 7e-33 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1) Lus10037245 [exp] 94 / 2e-25 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1) Lus10035660 [exp] 92 / 2e-24 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G254800 [exp] 155 / 1e-50 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1) Potri.013G089600 [exp] 114 / 3e-33 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1) Potri.014G156900 [exp] 39 / 0.0001 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF05899 [flax] [poplar] Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence Show only first row Show all	>Lus10014252 pacid=23164659 polypeptide=Lus10014252 locus=Lus10014252.g ID=Lus10014252.BGIv1.0 annot-version=v1.0 ATGAGCGATGAGCAGAGGCTGAGAATCAGCGTGGAGAGGAACCCTTCAGAAGCCAAGCTCAAGGAATTAAACTTCAAGAGTTGGCCCAAGTGGGGGTGTT CGCCGGGAAAGTACCAGCTTAAATTTGACGCGGAGGAGACTTGCTATTTGGTCAAAGGGAAAGTCAAAGTCTATCCGAAAAGCGGCGGAGGAGGAGGAGA GCAATCGTCGTCGTCGACAGAGTATGTAGAGTTCGGCGCCGGAGATCTGGTGGTGATTCCGAAGGGAATGAGCTGTACGTGGGATGTAACTGTCGCCGTG GACAAATACTACAAGTTTGAGTCGTCGCCGCCGCCGAGGCCTCCTCCATCCTTCCGGTAG
AA sequence Show only first row Show all	>Lus10014252 pacid=23164659 polypeptide=Lus10014252 locus=Lus10014252.g ID=Lus10014252.BGIv1.0 annot-version=v1.0 MSDEQRLRISVERNPSEAKLKELNFKSWPKWGCSPGKYQLKFDAEETCYLVKGKVKVYPKSGGGGGEQSSSSTEYVEFGAGDLVVIPKGMSCTWDVTVAV DKYYKFESSPPPRPPPSFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28703			RmlC-like cupins superfamily p...		Lus10014252 [exp]	0	1
AT1G23770			F-box family protein (.1)		Lus10006138 [exp]	4.2	0.8192
AT1G53440			Leucine-rich repeat transmembr...		Lus10005550 [exp]	5.9	0.8080
AT2G01860		EMB975	EMBRYO DEFECTIVE 975, Tetratri...		Lus10031347 [exp]	6.6	0.7960
AT2G23460		ATXLG1, XLG1	extra-large G-protein 1 (.1)		Lus10021012 [exp]	8.0	0.8205
AT4G28703			RmlC-like cupins superfamily p...		Lus10025947 [exp]	8.2	0.7409
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10041683 [exp]	9.5	0.8063
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10016173 [exp]	10.8	0.8154
AT2G04940			scramblase-related (.1)		Lus10010075 [exp]	12.6	0.7853
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Lus10010289 [exp]	14.5	0.7791
AT4G38900	bZIP	AtbZIP29	Basic-leucine zipper (bZIP) tr...		Lus10018061 [exp]	15.0	0.7664

Compare expression of checked genes

Lus10014252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.