Lus10014262 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09600 77 / 1e-19 GASA3 GAST1 protein homolog 3 (.1)
AT2G18420 71 / 6e-17 Gibberellin-regulated family protein (.1)
AT1G22690 69 / 4e-16 Gibberellin-regulated family protein (.1.2.3)
AT1G75750 66 / 4e-15 GASA1 GAST1 protein homolog 1 (.1.2)
AT1G74670 57 / 2e-11 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT5G14920 57 / 2e-10 Gibberellin-regulated family protein (.1.2)
AT5G15230 52 / 2e-09 GASA4 GAST1 protein homolog 4 (.1.2)
AT4G09610 51 / 2e-09 GASA2 GAST1 protein homolog 2 (.1)
AT5G59845 48 / 2e-08 Gibberellin-regulated family protein (.1)
AT1G10588 48 / 3e-08 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025962 150 / 4e-48 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10017212 69 / 3e-16 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10033145 66 / 4e-15 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10034524 66 / 8e-15 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10024338 63 / 9e-14 ND 78 / 3e-20
Lus10009421 62 / 1e-12 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10039443 60 / 6e-12 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10024791 55 / 9e-11 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1)
Lus10042012 55 / 1e-10 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G239000 81 / 6e-21 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.002G022700 74 / 4e-18 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.005G239100 73 / 7e-18 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 72 / 2e-17 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022500 69 / 4e-16 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.013G113400 67 / 7e-16 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.012G076700 64 / 2e-14 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.019G083900 63 / 7e-14 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.015G071500 63 / 9e-14 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.001G350600 57 / 9e-11 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Lus10014262 pacid=23164697 polypeptide=Lus10014262 locus=Lus10014262.g ID=Lus10014262.BGIv1.0 annot-version=v1.0
ATGGCATTCTCCAAAGCTAGAAGCTGTGTGGTGCTCATCATCATCCTGTCCGTGGTGCTTCTGCAGCAAATCGCAGAAGCTGCTGATCATCAGTTCGACT
TTCTAGAGGTTGCCACTGGTTATACTACTAGTCCAGCACCTCAGCCTGCTAATATTGCTATTAATGTATGGGGTGCATGGGCAGATTGTGGAGCGGCGTG
TGGGGTGAGATGCGGGAAGACGAAGAGGCCAAATCTGTGCAAAAGGGCATGCGGGAGCTGCTGCGCAAAGTGCGGGTGCGTCCCACCTGGCACATCTGGG
AACCACAACTTGTGTCCTTGCTATGCCAACCTCACCACCCGCTACCTACTCCCCAAATGCCCTTGA
AA sequence
>Lus10014262 pacid=23164697 polypeptide=Lus10014262 locus=Lus10014262.g ID=Lus10014262.BGIv1.0 annot-version=v1.0
MAFSKARSCVVLIIILSVVLLQQIAEAADHQFDFLEVATGYTTSPAPQPANIAINVWGAWADCGAACGVRCGKTKRPNLCKRACGSCCAKCGCVPPGTSG
NHNLCPCYANLTTRYLLPKCP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G09600 GASA3 GAST1 protein homolog 3 (.1) Lus10014262 0 1
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10027679 3.0 0.9540
Lus10024349 3.6 0.9571
AT1G64650 Major facilitator superfamily ... Lus10000336 7.5 0.9567
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Lus10043003 7.9 0.9493
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10028929 9.4 0.9488
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 11.1 0.9530
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10008603 13.0 0.9377
AT1G08590 Leucine-rich receptor-like pro... Lus10000814 13.6 0.9101
AT2G03350 Protein of unknown function, D... Lus10036804 13.6 0.9515
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10004348 14.0 0.9364

Lus10014262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.