Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025963 [exp] 139 / 1e-44 ND / Lus10041915 [exp] 48 / 2e-08 ND / Lus10034523 [exp] 38 / 0.0002 AT1G75717 45 / 1e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G114500 [exp] 74 / 2e-18 ND / Potri.005G238400 [exp] 36 / 0.0006 AT1G75717 52 / 1e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014263 pacid=23164690 polypeptide=Lus10014263 locus=Lus10014263.g ID=Lus10014263.BGIv1.0 annot-version=v1.0 ATGTCGTCCCTCCTCCACCGTTTGAGGGAATCTGTCTTCCGCCTCATGATGATCTCTGCGGATACTTCTTCTTCTTCAGATCGTCATCGGACGGTCGGAA GGGCGTCGTACCACGGGTACCTGGCTGATCCTTACCACAGCGAAGCAGTCGCGGATTGCATAGAGTTCATCAAGAAGACGGCGATAACGGACGGCGACCA CGAGGAGGAGGACGAGGTTAACGCCGTGATGCATGTCATGTGA
AA sequence Show only first row Show all	>Lus10014263 pacid=23164690 polypeptide=Lus10014263 locus=Lus10014263.g ID=Lus10014263.BGIv1.0 annot-version=v1.0 MSSLLHRLRESVFRLMMISADTSSSSDRHRTVGRASYHGYLADPYHSEAVADCIEFIKKTAITDGDHEEEDEVNAVMHVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014263 [exp]	0	1
AT5G51480		SKS2	SKU5 similar 2 (.1)		Lus10038920 [exp]	11.3	0.9052
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10022443 [exp]	12.0	0.8886
AT4G30420			nodulin MtN21 /EamA-like trans...		Lus10023211 [exp]	13.0	0.8813
AT3G45070			P-loop containing nucleoside t...		Lus10031624 [exp]	14.3	0.8724
AT4G11290			Peroxidase superfamily protein...		Lus10027163 [exp]	16.1	0.8867
AT5G05340			Peroxidase superfamily protein...		Lus10009935 [exp]	16.7	0.8652
AT3G19430			late embryogenesis abundant pr...		Lus10021837 [exp]	17.0	0.9017
AT5G42500			Disease resistance-responsive ...		Lus10021084 [exp]	17.9	0.8697
AT3G18180			Glycosyltransferase family 61 ...		Lus10036003 [exp]	18.4	0.8896
AT2G45220			Plant invertase/pectin methyle...		Lus10006103 [exp]	22.7	0.8084

Compare expression of checked genes

Lus10014263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.