Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18040 199 / 9e-68 PIN1AT "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) AT1G26550 62 / 3e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G19370 41 / 6e-05 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025967 [exp] 247 / 2e-85 AT2G18040 200 / 8e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Lus10019084 [exp] 61 / 1e-12 AT1G26550 225 / 4e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10015714 [exp] 60 / 3e-12 AT1G26550 224 / 1e-76 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G013400 [exp] 210 / 6e-72 AT2G18040 198 / 4e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Potri.008G089900 [exp] 62 / 3e-13 AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00639 [flax] [poplar] Rotamase PPIC-type PPIASE domain
Representative CDS sequence Show only first row Show all	>Lus10014266 pacid=23164660 polypeptide=Lus10014266 locus=Lus10014266.g ID=Lus10014266.BGIv1.0 annot-version=v1.0 ATGGCGTCGGGGAATCAGGTGAGGGCTTCCCACATACTGATAAAGCACGAGGGATCCCGCAGGAAAGCTTCGTGGAAGGACCCGGAAGGCCGTGTCATCA TGAACACCACCAAAGAGAGCGCCATCGCTACCCTCAAACAGTTCCGCGAGGATATCCTCTCTGGGAAGGCTAAGTTCGACGACGTTGCAGCTCGCCACTC TGATTGCAGCTCTGCCAAGCGCGGCGGGGATCTCGGTCCATTTGGACGTGGGCAGATGCAAAAGCCTTTTGAAGATGCAACATTTGCCCTGAAAGTTGGC GACATAAGCGACATAGTGGACACCGACAGTGGTGTTCACATCATACTCAGAACTGCTTAG
AA sequence Show only first row Show all	>Lus10014266 pacid=23164660 polypeptide=Lus10014266 locus=Lus10014266.g ID=Lus10014266.BGIv1.0 annot-version=v1.0 MASGNQVRASHILIKHEGSRRKASWKDPEGRVIMNTTKESAIATLKQFREDILSGKAKFDDVAARHSDCSSAKRGGDLGPFGRGQMQKPFEDATFALKVG DISDIVDTDSGVHIILRTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Lus10014266 [exp]	0	1
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Lus10025967 [exp]	1.0	0.8706
AT1G29790			S-adenosyl-L-methionine-depend...		Lus10015264 [exp]	7.6	0.8171
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10000536 [exp]	8.7	0.8010
AT5G13450		ATP5	delta subunit of Mt ATP syntha...		Lus10016414 [exp]	13.4	0.7892
AT3G27230			S-adenosyl-L-methionine-depend...		Lus10034506 [exp]	14.3	0.7490
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10037033 [exp]	18.4	0.7984
AT5G27440			unknown protein		Lus10041604 [exp]	19.6	0.7471
AT2G40060		CLC2	clathrin light chain 2, Clathr...		Lus10040187 [exp]	19.6	0.7325
AT1G22310		ATMBD8, MBD8	methyl-CPG-binding domain 8 (....		Lus10033445 [exp]	20.3	0.7375
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028449 [exp]	21.9	0.7790

Compare expression of checked genes

Lus10014266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.