Lus10014267 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18050 98 / 6e-27 HIS1-3 histone H1-3 (.1.2)
AT2G30620 61 / 5e-12 winged-helix DNA-binding transcription factor family protein (.1.2)
AT1G06760 50 / 8e-08 winged-helix DNA-binding transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025968 115 / 8e-33 AT2G18050 132 / 6e-39 histone H1-3 (.1.2)
Lus10042541 68 / 4e-14 AT2G30620 121 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10022001 67 / 8e-14 AT2G30620 115 / 3e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10006562 59 / 2e-11 AT2G30620 112 / 2e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10005534 58 / 1e-10 AT2G30620 116 / 9e-32 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10005535 54 / 3e-09 AT2G30620 124 / 8e-35 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10006561 51 / 3e-08 AT2G30620 115 / 1e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10014653 43 / 4e-05 AT5G15340 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10033775 41 / 0.0001 AT5G15340 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G116600 99 / 9e-27 AT2G18050 117 / 3e-33 histone H1-3 (.1.2)
Potri.007G014200 94 / 8e-25 AT2G18050 109 / 2e-30 histone H1-3 (.1.2)
Potri.008G162300 59 / 2e-11 AT2G30620 76 / 2e-17 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.010G076800 59 / 2e-11 AT1G06760 77 / 4e-17 winged-helix DNA-binding transcription factor family protein (.1)
Potri.013G042700 57 / 8e-11 AT2G30620 66 / 2e-13 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.002G199900 51 / 2e-08 AT2G30620 84 / 4e-20 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.005G219800 51 / 3e-08 AT1G06760 89 / 1e-20 winged-helix DNA-binding transcription factor family protein (.1)
Potri.002G043100 46 / 2e-06 AT2G30620 92 / 3e-22 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.014G004900 44 / 1e-05 AT5G67580 224 / 6e-72 TELOMERE-BINDING PROTEIN 3, TELOMERE REPEAT BINDING FACTOR 2, Homeodomain-like/winged-helix DNA-binding family protein (.1.2)
Potri.009G087000 42 / 4e-05 AT1G49950 277 / 5e-93 telomere repeat binding factor 1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF00538 Linker_histone linker histone H1 and H5 family
Representative CDS sequence
>Lus10014267 pacid=23164728 polypeptide=Lus10014267 locus=Lus10014267.g ID=Lus10014267.BGIv1.0 annot-version=v1.0
ATGGCTGATGACAAGGAAAATCAAGTTCCAGTCACTGATCCTCAAGTAGTGCAGCCACCGGCGCCGGGAGGAGGAGCAGAAGAAGCCGGTGGGAGAAAAC
CGCCGCTCATCCACCTTATTTCCAGGTACTTAGGCCACGTTTTCCGCTATTTTGGATTCAAGGCCAAATATATGATCAAAGAAGCTTTGATGGCGTTGGA
CGAGAAGAGCGGATCGAGCCCGTACGCTATAGCGAAGAAAATGGAGGAAAAGCACAAAGCGGTGCTTCCAGCTAATTTCAGGAAGACTCTGGCGGTGCAG
CTGAAGAACTCGGAAGCCAAGGGGAAGCTGATCAAAATCAAAGCTTCTTACAAGCTCCCGTCATCCGAGTCGGGAAAGAAGAAGAAGGAGAATAAATCAT
CATCTCATCCTCCGTGA
AA sequence
>Lus10014267 pacid=23164728 polypeptide=Lus10014267 locus=Lus10014267.g ID=Lus10014267.BGIv1.0 annot-version=v1.0
MADDKENQVPVTDPQVVQPPAPGGGAEEAGGRKPPLIHLISRYLGHVFRYFGFKAKYMIKEALMALDEKSGSSPYAIAKKMEEKHKAVLPANFRKTLAVQ
LKNSEAKGKLIKIKASYKLPSSESGKKKKENKSSSHPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18050 HIS1-3 histone H1-3 (.1.2) Lus10014267 0 1
AT5G46030 unknown protein Lus10015293 2.4 0.8900
AT1G76570 Chlorophyll A-B binding family... Lus10015235 3.5 0.8617
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10010188 4.2 0.8624
AT5G11900 Translation initiation factor ... Lus10024986 4.5 0.8520
AT4G27130 Translation initiation factor ... Lus10031550 5.0 0.8467
AT1G66980 GDPDL2, SNC4 Glycerophosphodiester phosphod... Lus10022359 8.5 0.8283
AT5G59610 Chaperone DnaJ-domain superfam... Lus10016510 9.4 0.8393
AT3G08890 Protein of unknown function, D... Lus10022674 13.0 0.8165
AT1G56423 unknown protein Lus10029844 13.0 0.8425
AT4G01790 Ribosomal protein L7Ae/L30e/S1... Lus10007191 15.5 0.8152

Lus10014267 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.