Lus10014281 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G56940 211 / 7e-72 Ribosomal protein S16 family protein (.1)
AT4G34620 145 / 6e-46 SSR16 small subunit ribosomal protein 16 (.1)
ATCG00050 50 / 6e-09 ATCG00050.1, RPS16 ribosomal protein S16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025984 259 / 6e-91 AT5G56940 208 / 1e-70 Ribosomal protein S16 family protein (.1)
Lus10025592 134 / 1e-41 AT4G34620 137 / 2e-43 small subunit ribosomal protein 16 (.1)
Lus10027058 132 / 5e-41 AT4G34620 136 / 4e-43 small subunit ribosomal protein 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G217400 222 / 5e-76 AT5G56940 188 / 7e-63 Ribosomal protein S16 family protein (.1)
Potri.013G128200 138 / 2e-43 AT4G34620 139 / 6e-44 small subunit ribosomal protein 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00886 Ribosomal_S16 Ribosomal protein S16
Representative CDS sequence
>Lus10014281 pacid=23164750 polypeptide=Lus10014281 locus=Lus10014281.g ID=Lus10014281.BGIv1.0 annot-version=v1.0
ATGGTCGTAAGGATCCGATTATCGAGGTTTGGCTGCAAGAACAAGCCGTTTTATCGTGTCATGGCTGCTGATAGCAGATCTCCTCGAGATGGAAAACACC
TTGAAGTATTGGGCTACTACAATCCATTGCCTGGTCAAGATGGTGGCAAAAGAATGGGTCTAAATTTCGAGCGAGTAAAATATTGGTTGTCAGTCGGTGC
TCAAGCCTCAGATCCTGTACAAAGGATTCTGTTCAGGGCAGGGGTTCTCCCTCCGCCACCTATGGTGGCTATGGGACGCAAGGGTGGACCACGTGATACC
CGTCCTGTCGATCCGCTTACTGGACGAGTATTGAACCAGGAGAAGGCAGCCACAGGAACAGAGTCAACTACTTCTGATGATGCAGCCGTAGTGTCTACAT
CATGA
AA sequence
>Lus10014281 pacid=23164750 polypeptide=Lus10014281 locus=Lus10014281.g ID=Lus10014281.BGIv1.0 annot-version=v1.0
MVVRIRLSRFGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDGGKRMGLNFERVKYWLSVGAQASDPVQRILFRAGVLPPPPMVAMGRKGGPRDT
RPVDPLTGRVLNQEKAATGTESTTSDDAAVVSTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G56940 Ribosomal protein S16 family p... Lus10014281 0 1
AT5G62440 Protein of unknown function (D... Lus10035009 2.2 0.7977
AT3G09890 Ankyrin repeat family protein ... Lus10023911 4.9 0.7557
AT2G09990 Ribosomal protein S5 domain 2-... Lus10009252 5.5 0.7873
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10029320 6.8 0.7884
AT3G56570 SET domain-containing protein ... Lus10026538 8.4 0.7142
AT3G19508 unknown protein Lus10013875 14.3 0.7196
AT1G52980 AtNug2 nuclear/nucleolar GTPase 2, GT... Lus10021016 17.3 0.7186
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 18.3 0.7502
AT3G10950 Zinc-binding ribosomal protein... Lus10011359 21.0 0.7245
AT3G53740 Ribosomal protein L36e family ... Lus10016501 22.7 0.7511

Lus10014281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.