Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50900 69 / 3e-16 unknown protein AT4G36500 67 / 3e-15 unknown protein AT2G18210 64 / 4e-14 unknown protein AT5G66490 63 / 8e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025997 [exp] 203 / 4e-69 AT4G36500 73 / 1e-17 unknown protein Lus10025998 [exp] 197 / 1e-66 AT2G18210 72 / 3e-17 unknown protein Lus10028324 [exp] 124 / 9e-38 AT2G18210 88 / 1e-23 unknown protein Lus10041771 [exp] 122 / 3e-37 AT2G18210 88 / 1e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G022300 [exp] 87 / 3e-23 AT3G50900 84 / 3e-22 unknown protein Potri.007G022200 [exp] 68 / 2e-15 AT2G18210 56 / 8e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014291 pacid=23164662 polypeptide=Lus10014291 locus=Lus10014291.g ID=Lus10014291.BGIv1.0 annot-version=v1.0 ATGTTGAGAGCATTGAGCACTCGCATAAGCCAATACAAGTACGACAAGCTAGCTGATGAATCTCCCATGGGTCCTCTGATTGGCGGCTATAAGCTTACAA GGAGCAGAACTCTGCCAGTTCAGTTTCTTGGGGAGCGATCATCCAGTTACAAGCTATCTCTTAATTTGCATTTACCAGCAGCAGTACTACCTGCGCCCAA GAAGGCAGACAGCAAAAGCCACCCTCTTTTGAGCCTGTTCAATTCTCGACGGAAGAAGAGAACTACTTCAAGGCCAGAGTTCGCTAGGTACATCCAGTAT GTCAAGGAAGGTGGATTGTGGGATGCTAATTCTGGCCTACCTGTCATGTATTACAAGTAG
AA sequence Show only first row Show all	>Lus10014291 pacid=23164662 polypeptide=Lus10014291 locus=Lus10014291.g ID=Lus10014291.BGIv1.0 annot-version=v1.0 MLRALSTRISQYKYDKLADESPMGPLIGGYKLTRSRTLPVQFLGERSSSYKLSLNLHLPAAVLPAPKKADSKSHPLLSLFNSRRKKRTTSRPEFARYIQY VKEGGLWDANSGLPVMYYK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36500			unknown protein		Lus10014291 [exp]	0	1
AT5G07100	WRKY	WRKY26	WRKY DNA-binding protein 26 (....		Lus10042243 [exp]	1.4	0.9292
AT1G56240		ATPP2-B13	phloem protein 2-B13 (.1)		Lus10031471 [exp]	2.2	0.9441
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031473 [exp]	5.7	0.9219
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031472 [exp]	5.9	0.9103
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Lus10001265 [exp]	5.9	0.9206
AT3G59080			Eukaryotic aspartyl protease f...		Lus10007335 [exp]	6.0	0.9223
AT1G30755			Protein of unknown function (D...		Lus10017260 [exp]	6.0	0.8975
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Lus10035262 [exp]	6.2	0.8843
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Lus10022343 [exp]	7.5	0.9086
AT4G24160			alpha/beta-Hydrolases superfam...		Lus10024310 [exp]	8.5	0.8792

Compare expression of checked genes

Lus10014291 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.