Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18400 179 / 4e-60 ribosomal protein L6 family protein (.1) AT1G05190 88 / 1e-22 EMB2394 embryo defective 2394, Ribosomal protein L6 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026015 [exp] 209 / 3e-71 AT2G18400 181 / 1e-59 ribosomal protein L6 family protein (.1) Lus10029120 [exp] 76 / 4e-18 AT1G05190 312 / 5e-109 embryo defective 2394, Ribosomal protein L6 family (.1) Lus10013041 [exp] 76 / 1e-17 AT1G05190 310 / 3e-107 embryo defective 2394, Ribosomal protein L6 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G024900 [exp] 202 / 2e-69 AT2G18400 173 / 6e-58 ribosomal protein L6 family protein (.1) Potri.014G153000 [exp] 83 / 7e-21 AT1G05190 338 / 3e-119 embryo defective 2394, Ribosomal protein L6 family (.1) Potri.002G229350 [exp] 72 / 2e-17 AT1G05190 138 / 3e-42 embryo defective 2394, Ribosomal protein L6 family (.1) Potri.002G229325 [exp] 73 / 4e-17 AT1G05190 272 / 2e-93 embryo defective 2394, Ribosomal protein L6 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00347 [flax] [poplar] Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence Show only first row Show all	>Lus10014306 pacid=23164685 polypeptide=Lus10014306 locus=Lus10014306.g ID=Lus10014306.BGIv1.0 annot-version=v1.0 ATGGAGGCCAAATTCTTCCGATTTCTGAAGATTGTTGGTGTTGGGTATAAAGCGAGAGCTGAATCAGAAGGGCGCTTGTTGTTTCTGAAATTGGGTTACA GTCATGAAGTGGAGCTGACAGTTCCCCCAGCTGTTAGGGTTTTCTGCTTCAAGAACAATGTGGTTTGCTGCACTGGGATTGACAAGCAAAGGGTGCACCA ATTTGCTGCTACTGTGCGTAGTTGCAAGCCTCCAGAAGTCTATAAAGGCAAAGGCATCATGTACATCGATGAAGTGATCAAGAAGAAACAGGGCAAGAAA TCCAAATAA
AA sequence Show only first row Show all	>Lus10014306 pacid=23164685 polypeptide=Lus10014306 locus=Lus10014306.g ID=Lus10014306.BGIv1.0 annot-version=v1.0 MEAKFFRFLKIVGVGYKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGIDKQRVHQFAATVRSCKPPEVYKGKGIMYIDEVIKKKQGKK SK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18400			ribosomal protein L6 family pr...		Lus10014306 [exp]	0	1
AT2G18400			ribosomal protein L6 family pr...		Lus10026015 [exp]	2.4	0.8670
AT1G16000			unknown protein		Lus10011478 [exp]	4.6	0.8071
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	4.9	0.8414
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	6.6	0.7770
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	8.9	0.8270
AT3G23390			Zinc-binding ribosomal protein...		Lus10013436 [exp]	10.2	0.8314
AT2G43780			unknown protein		Lus10035718 [exp]	12.0	0.7934
AT5G60340			P-loop containing nucleoside t...		Lus10016525 [exp]	12.7	0.7827
AT1G47278			unknown protein		Lus10040837 [exp]	13.1	0.7407
AT2G19740			Ribosomal protein L31e family ...		Lus10042028 [exp]	13.6	0.8129

Compare expression of checked genes

Lus10014306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.