Lus10014329 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36800 334 / 5e-118 RCE1 RUB1 conjugating enzyme 1 (.1.2)
AT2G18600 317 / 3e-111 Ubiquitin-conjugating enzyme family protein (.1)
AT5G56150 101 / 5e-27 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G53300 101 / 8e-27 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G41700 101 / 1e-26 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 100 / 2e-26 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 100 / 3e-26 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT4G27960 99 / 7e-26 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 98 / 1e-25 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08700 92 / 2e-23 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026038 376 / 2e-134 AT4G36800 341 / 1e-121 RUB1 conjugating enzyme 1 (.1.2)
Lus10010143 268 / 1e-91 AT4G36800 257 / 1e-88 RUB1 conjugating enzyme 1 (.1.2)
Lus10028700 105 / 2e-28 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 105 / 2e-28 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10027846 100 / 3e-26 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 97 / 3e-25 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 97 / 3e-25 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 97 / 4e-25 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10014942 97 / 6e-25 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G030900 356 / 1e-126 AT4G36800 340 / 2e-121 RUB1 conjugating enzyme 1 (.1.2)
Potri.005G126500 340 / 4e-120 AT4G36800 332 / 3e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.T125904 332 / 7e-117 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.009G113045 332 / 7e-117 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041532 132 / 2e-39 AT4G36800 137 / 5e-42 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041466 114 / 6e-33 AT2G18600 104 / 3e-30 Ubiquitin-conjugating enzyme family protein (.1)
Potri.004G175000 101 / 8e-27 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 99 / 9e-26 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 98 / 1e-25 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 98 / 1e-25 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10014329 pacid=23164709 polypeptide=Lus10014329 locus=Lus10014329.g ID=Lus10014329.BGIv1.0 annot-version=v1.0
ATGATTCGTTTGTTTAAAGTTAAGGAACAGCAGAGAGAACAAGCTGAGAATGCCAATGGAGGAATGCCAGTTAAAAAGCAAAGTGCTGGAGAGCTCCGGC
TTCACAAGGATATTTCCGAGCTGAACCTTCCCAAGTCATGTGCCATAACGTTCCCCAATGGCAAAGACGACCTGATGAACTTTGAGGTTTCGATTCGCCC
AGATGAAGGGTATTATGCAGGTGGAACGTTTTTATTCACTTTCCAAGTCTCTCCTATCTATCCGCACGAGGCACCGAAAGTTAAATGCAAGACAAAGGTG
TACCATCCAAACATCGACTTAGAGGGAAATGTTTGTCTTAACATATTGCGAGAAGACTGGAAGCCAGTTCTTAACATCAATACTATTATCTACGGACTAT
ATCATCTATTTACGGAGCCAAACTACGAGGATCCTCTGAATCACGAAGCGGCTGCGGTGTTGAGGGATCATCCAAAGATGTTTGAATCAAACGTGAGGAG
GGCTATGACTGGAGGCTATGTCGGGCAGACGGAAGTGGCAGCTGTTCGCCACCCCTCCCATAGGGCCATCGTTCTAGCCCTCAAGGATACATGGAATTCC
GTTGTCGCCACCTCAGGTCAAGCTCTCTGCCGCCACATCATGGAACCTCTCACCTTGGAGTTCATGGCCATTCGGCTAGTCTTGGATGCTGATTCGCGTT
GGCAGTTGGGCACTCTTTCCATTTACACAAATTCCACATAA
AA sequence
>Lus10014329 pacid=23164709 polypeptide=Lus10014329 locus=Lus10014329.g ID=Lus10014329.BGIv1.0 annot-version=v1.0
MIRLFKVKEQQREQAENANGGMPVKKQSAGELRLHKDISELNLPKSCAITFPNGKDDLMNFEVSIRPDEGYYAGGTFLFTFQVSPIYPHEAPKVKCKTKV
YHPNIDLEGNVCLNILREDWKPVLNINTIIYGLYHLFTEPNYEDPLNHEAAAVLRDHPKMFESNVRRAMTGGYVGQTEVAAVRHPSHRAIVLALKDTWNS
VVATSGQALCRHIMEPLTLEFMAIRLVLDADSRWQLGTLSIYTNST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36800 RCE1 RUB1 conjugating enzyme 1 (.1.... Lus10014329 0 1
AT2G38900 Serine protease inhibitor, pot... Lus10003225 1.4 0.9145
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Lus10039887 2.0 0.8957
AT2G21870 MGP1 MALE GAMETOPHYTE DEFECTIVE 1, ... Lus10005794 4.7 0.8788
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10025309 5.3 0.9057
AT4G31540 ATEXO70G1 exocyst subunit exo70 family p... Lus10018672 8.0 0.8729
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Lus10003808 8.1 0.8986
AT3G05760 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10010928 8.9 0.8802
AT2G38900 Serine protease inhibitor, pot... Lus10035626 9.2 0.8891
AT2G23940 Protein of unknown function (D... Lus10041903 9.5 0.8754
AT3G12760 unknown protein Lus10009599 10.1 0.8512

Lus10014329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.