Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10130 154 / 1e-48 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 136 / 2e-41 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 114 / 1e-32 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 91 / 2e-23 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 88 / 3e-22 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 86 / 1e-21 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 42 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 39 / 0.0005 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026040 [exp] 313 / 3e-111 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 234 / 9e-80 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 132 / 9e-40 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 130 / 3e-39 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 101 / 2e-27 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 96 / 2e-23 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10028134 [exp] 88 / 2e-22 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 85 / 4e-21 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 81 / 2e-19 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G078200 [exp] 178 / 4e-58 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 176 / 3e-57 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 151 / 2e-47 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 150 / 6e-47 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 102 / 4e-28 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 94 / 1e-24 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 1e-08 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 51 / 6e-08 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 46 / 2e-06 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 45 / 9e-06 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10014332 pacid=23164670 polypeptide=Lus10014332 locus=Lus10014332.g ID=Lus10014332.BGIv1.0 annot-version=v1.0 ATGACCTCCACAGCTCGCTGCTCGTTGCTAATTCTAGCCATCCTCTGTGTCGTCCTTCCCGTACTAACCACATCCAAGTTCGCGCCCTTCGTCATTCGGG GCAGCGTATACTGTGATACTTGCCGTTGCGGCTTTGAGACCAACAAAACCACTTACATCCAAGGGGCGAAGGTAGCGATCAAGTGCAAGGACAGGCAAAC ATTGCAGAGGAAGTACAGCAACGATGCGACGACGGATAAGAACGGCGTGTATCAGATCACCGTCGAGGATGATCATGGCGACCAGATTTGCGAGTCTGTC CTCGTCAGCAGCCCTTTAGAAAACTGCAAGGTTGCGGATCCGGGTCGATCCTATTCGGAAGTCATCTTGACCCGCTCCAACGGCGCCATCTCTAATCTTC ATTTTGCGAATGCTATGGGTTTTCTCAAGGGCGAAGCGGAGGAGGGTTGTACTGAGCTCGTCCACGAACTACTCTTCTCCGATCTTTGA
AA sequence Show only first row Show all	>Lus10014332 pacid=23164670 polypeptide=Lus10014332 locus=Lus10014332.g ID=Lus10014332.BGIv1.0 annot-version=v1.0 MTSTARCSLLILAILCVVLPVLTTSKFAPFVIRGSVYCDTCRCGFETNKTTYIQGAKVAIKCKDRQTLQRKYSNDATTDKNGVYQITVEDDHGDQICESV LVSSPLENCKVADPGRSYSEVILTRSNGAISNLHFANAMGFLKGEAEEGCTELVHELLFSDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10014332 [exp]	0	1
AT5G20260			Exostosin family protein (.1)		Lus10005186 [exp]	2.8	0.9204
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10032282 [exp]	3.2	0.9389
					Lus10005096 [exp]	6.3	0.9142
AT3G46170			NAD(P)-binding Rossmann-fold s...		Lus10006696 [exp]	6.5	0.8798
AT2G17080			Arabidopsis protein of unknown...		Lus10025119 [exp]	8.1	0.9161
AT3G05390			unknown protein		Lus10004494 [exp]	8.4	0.9135
AT4G35200			Arabidopsis protein of unknown...		Lus10023953 [exp]	12.0	0.8967
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10026040 [exp]	13.9	0.9133
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10001132 [exp]	14.9	0.8882
AT2G12646			PLATZ transcription factor fam...		Lus10039989 [exp]	18.2	0.8974

Compare expression of checked genes

Lus10014332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.