Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10490 51 / 6e-08 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) AT1G71930 51 / 8e-08 NAC VND7, ANAC030 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) AT5G66300 50 / 2e-07 NAC ANAC105, VND3 VASCULAR-RELATED NAC-DOMAIN 3, Arabidopsis NAC domain containing protein 105, NAC domain containing protein 105 (.1) AT1G01010 49 / 5e-07 NAC ANAC001 NAC domain containing protein 1 (.1) AT3G10480 49 / 5e-07 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT1G54330 47 / 1e-06 NAC ANAC020 NAC domain containing protein 20 (.1) AT5G39610 47 / 2e-06 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT3G03200 47 / 2e-06 NAC ANAC045 NAC domain containing protein 45 (.1) AT5G17260 47 / 3e-06 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G33280 46 / 4e-06 NAC BRN1, ANAC015, NST5 BEARSKIN 1, NAC domain containing protein 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035400 [exp] 200 / 4e-65 AT1G79580 61 / 1e-10 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10019638 [exp] 180 / 3e-57 AT1G12260 59 / 4e-10 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10033652 [exp] 139 / 6e-41 AT1G62700 54 / 2e-08 VASCULAR RELATED NAC-DOMAIN PROTEIN 5, Arabidopsis NAC domain containing protein 26 (.1) Lus10033650 [exp] 112 / 1e-31 AT3G03200 50 / 8e-08 NAC domain containing protein 45 (.1) Lus10033676 [exp] 86 / 1e-19 AT3G10480 72 / 4e-13 NAC domain containing protein 50 (.1.2.3) Lus10025078 [exp] 79 / 2e-17 AT1G79580 69 / 1e-12 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10024006 [exp] 78 / 9e-17 AT1G79580 75 / 3e-14 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10010294 [exp] 61 / 5e-11 AT5G46590 59 / 1e-09 NAC domain containing protein 96 (.1) Lus10009858 [exp] 60 / 8e-11 AT5G62380 53 / 1e-07 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G163600 [exp] 73 / 2e-15 AT5G62380 58 / 3e-09 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Potri.015G002900 [exp] 73 / 3e-15 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.006G028700 [exp] 67 / 2e-13 AT2G24430 65 / 1e-11 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.017G058100 [exp] 67 / 4e-13 AT5G62380 49 / 4e-06 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Potri.006G231300 [exp] 65 / 2e-12 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Potri.016G027900 [exp] 64 / 2e-12 AT2G24430 66 / 8e-12 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.006G029200 [exp] 60 / 5e-11 AT3G10480 67 / 8e-13 NAC domain containing protein 50 (.1.2.3) Potri.006G028300 [exp] 57 / 7e-10 AT3G10480 74 / 5e-14 NAC domain containing protein 50 (.1.2.3) Potri.019G063000 [exp] 53 / 1e-08 AT1G79580 56 / 4e-09 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.019G083600 [exp] 50 / 2e-07 AT1G71930 320 / 4e-109 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10014342 pacid=23164733 polypeptide=Lus10014342 locus=Lus10014342.g ID=Lus10014342.BGIv1.0 annot-version=v1.0 ATGGATCATGATAGCTCGCAGATAGCTTTGATGGAGAGAAGGAAGGCCTACTTTGCATCCTTGAACCTGCATTCGGGAATTAGGTTCCGCCCAACCGATA AGCAATTGATCGGCCAATTTCTCATCCCCAAGATCAGACGAGGAGACGCTGTCGACGAGGAAGATCCGATAAAGGAGGTGGACGCCTATTCGGTGGAGCC GTGGGATCTCTGGACCCGATTCTCGGACGACGATGACAAAGGGGCGGATCTCTACTTCTACACAAAACTGAAGCGCAAGTCCTCGAAGGTGATTGAGCGG GTAATCGCCGGAGGGAAGGCGACGTGGCATGGGGAGACAGCCGGTAAGGAAATTCAAGTCAATTACATTCGGAAAGACCAGAAGACGAAGAAAGTGTTGA GTACGTGCAGGCTCAAATTCGAGATAAGGAGGTTCAGTTACAAGAACCCCGGACACCCGGAGCACCGCCGTTGGATCATGCTCGAGTACAAAGGTGTTTC CGCAGCTGATTGGGTGATTTTCCGTCTCCGTAAAACCCCGGAAAAAACCCAGAGATCGAGATAG
AA sequence Show only first row Show all	>Lus10014342 pacid=23164733 polypeptide=Lus10014342 locus=Lus10014342.g ID=Lus10014342.BGIv1.0 annot-version=v1.0 MDHDSSQIALMERRKAYFASLNLHSGIRFRPTDKQLIGQFLIPKIRRGDAVDEEDPIKEVDAYSVEPWDLWTRFSDDDDKGADLYFYTKLKRKSSKVIER VIAGGKATWHGETAGKEIQVNYIRKDQKTKKVLSTCRLKFEIRRFSYKNPGHPEHRRWIMLEYKGVSAADWVIFRLRKTPEKTQRSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10490	NAC	ANAC051, ANAC05...	Arabidopsis NAC domain contain...		Lus10014342 [exp]	0	1
					Lus10036838 [exp]	9.1	0.5370
					Lus10036841 [exp]	12.8	0.5370
					Lus10043259 [exp]	22.0	0.5276
AT2G21100			Disease resistance-responsive ...		Lus10034480 [exp]	23.8	0.4935
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011999 [exp]	25.5	0.5326
AT5G42540		AtXRN2, XRN2	exoribonuclease 2 (.1.2)		Lus10009577 [exp]	47.7	0.4904
AT4G00980			zinc knuckle (CCHC-type) famil...		Lus10020454 [exp]	50.2	0.4828
AT5G01150			Protein of unknown function (D...		Lus10002340 [exp]	52.4	0.4794
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	57.4	0.4874
AT1G60630			Leucine-rich repeat protein ki...		Lus10019429 [exp]	61.6	0.4847

Compare expression of checked genes

Lus10014342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.