Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80720 122 / 1e-36 Mitochondrial glycoprotein family protein (.1) AT1G15870 121 / 1e-35 Mitochondrial glycoprotein family protein (.1) AT4G31930 76 / 3e-18 Mitochondrial glycoprotein family protein (.1) AT5G02050 68 / 5e-15 Mitochondrial glycoprotein family protein (.1) AT2G39795 64 / 1e-13 Mitochondrial glycoprotein family protein (.1) AT5G05990 61 / 2e-12 Mitochondrial glycoprotein family protein (.1) AT3G55605 60 / 5e-12 Mitochondrial glycoprotein family protein (.1) AT4G32605 54 / 8e-10 Mitochondrial glycoprotein family protein (.1) AT2G39790 44 / 2e-06 Mitochondrial glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026060 [exp] 176 / 4e-57 AT1G15870 263 / 4e-89 Mitochondrial glycoprotein family protein (.1) Lus10018327 [exp] 99 / 9e-27 AT4G31930 243 / 2e-81 Mitochondrial glycoprotein family protein (.1) Lus10017126 [exp] 94 / 5e-25 AT4G31930 240 / 3e-80 Mitochondrial glycoprotein family protein (.1) Lus10024351 [exp] 67 / 1e-14 AT5G02050 231 / 6e-76 Mitochondrial glycoprotein family protein (.1) Lus10001017 [exp] 66 / 2e-14 AT3G55605 199 / 2e-64 Mitochondrial glycoprotein family protein (.1) Lus10030157 [exp] 66 / 3e-14 AT3G55605 236 / 6e-78 Mitochondrial glycoprotein family protein (.1) Lus10012653 [exp] 65 / 3e-14 AT5G02050 201 / 2e-65 Mitochondrial glycoprotein family protein (.1) Lus10001015 [exp] 66 / 4e-14 AT3G55605 232 / 1e-76 Mitochondrial glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G047600 [exp] 136 / 1e-41 AT1G15870 256 / 2e-86 Mitochondrial glycoprotein family protein (.1) Potri.018G021600 [exp] 103 / 9e-29 AT4G31930 259 / 1e-87 Mitochondrial glycoprotein family protein (.1) Potri.006G090700 [exp] 67 / 9e-15 AT5G02050 228 / 9e-75 Mitochondrial glycoprotein family protein (.1) Potri.016G102200 [exp] 59 / 1e-11 AT5G02050 216 / 4e-70 Mitochondrial glycoprotein family protein (.1) Potri.010G198500 [exp] 58 / 3e-11 AT3G55605 210 / 1e-67 Mitochondrial glycoprotein family protein (.1) Potri.010G198600 [exp] 55 / 4e-10 AT2G39795 222 / 1e-72 Mitochondrial glycoprotein family protein (.1) Potri.010G244500 [exp] 48 / 7e-08 AT4G32605 242 / 3e-81 Mitochondrial glycoprotein family protein (.1) Potri.008G015600 [exp] 46 / 5e-07 AT4G32605 262 / 2e-88 Mitochondrial glycoprotein family protein (.1) Potri.006G046350 [exp] 42 / 2e-05 AT2G41600 210 / 2e-69 Mitochondrial glycoprotein family protein (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02330 [flax] [poplar] MAM33 Mitochondrial glycoprotein
Representative CDS sequence Show only first row Show all	>Lus10014351 pacid=23164737 polypeptide=Lus10014351 locus=Lus10014351.g ID=Lus10014351.BGIv1.0 annot-version=v1.0 ATGAATCAAACTCAAGTCAATGATGTTCTAGAGATCATGTGCTCAGCTTGGCCTGACACCATTGAAATTACCAAGCTTTTTATACGGACTCCAACGAAGA TGCCTGCGAAACCTTACGTTTGTCCTGGTTTCAAGGAACTGGATGACGAGCTGCAAGACTCGCTTTACGAGTTCTTAGAGGCAGGGGGTATAGGTGACGA GATTGCTGTTTTCTTGCACGGATATGTCGCAAACAAAGGTAATACAGAATACATAAGGTGGGTGGATACTGTGAAATCGTACATGGAGAAGCAGTAG
AA sequence Show only first row Show all	>Lus10014351 pacid=23164737 polypeptide=Lus10014351 locus=Lus10014351.g ID=Lus10014351.BGIv1.0 annot-version=v1.0 MNQTQVNDVLEIMCSAWPDTIEITKLFIRTPTKMPAKPYVCPGFKELDDELQDSLYEFLEAGGIGDEIAVFLHGYVANKGNTEYIRWVDTVKSYMEKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80720			Mitochondrial glycoprotein fam...		Lus10014351 [exp]	0	1

Compare expression of checked genes

Lus10014351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.