Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25344 41 / 3e-06 LCR14 low-molecular-weight cysteine-rich 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014355 [exp] 128 / 9e-41 AT2G25344 49 / 2e-09 low-molecular-weight cysteine-rich 14 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF07333 [flax] [poplar] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Lus10014354 pacid=23164754 polypeptide=Lus10014354 locus=Lus10014354.g ID=Lus10014354.BGIv1.0 annot-version=v1.0 ATGGCTTCTGCTTTCGCGATCGTTCTCTTGCTTCTTACCACGGTCACCATTCATGGTGTTGCAAGTGGAGTTGTTGGAGTGGATGCAAAAAGATGCATCG CTGTGTTGTATGAAGGAGCCTGTGAAGAGGACCAATGCACTAGTGATTGTATTACAAAGCATGGCAAGAAATCCTTTGGGTTTTGCGGTACCGGTGATGG TGTTTGTACTTGCGATTACGATTGTTAA
AA sequence Show only first row Show all	>Lus10014354 pacid=23164754 polypeptide=Lus10014354 locus=Lus10014354.g ID=Lus10014354.BGIv1.0 annot-version=v1.0 MASAFAIVLLLLTTVTIHGVASGVVGVDAKRCIAVLYEGACEEDQCTSDCITKHGKKSFGFCGTGDGVCTCDYDC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25344		LCR14	low-molecular-weight cysteine-...		Lus10014354 [exp]	0	1
AT5G39300		ATHEXPALPHA1.18...	EXPANSIN 25, expansin A25 (.1)		Lus10000305 [exp]	16.5	0.4934
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10027327 [exp]	32.8	0.5073
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10030411 [exp]	34.5	0.4721
					Lus10013414 [exp]	36.4	0.4629
AT2G14378			Protein of unknown function (D...		Lus10019428 [exp]	40.4	0.4707
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10003847 [exp]	43.0	0.4618
AT1G58520		RXW8	lipases;hydrolases, acting on ...		Lus10036752 [exp]	63.7	0.4835
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10005660 [exp]	72.3	0.4318
AT1G01280		CYP703A2	"cytochrome P450, family 703, ...		Lus10010119 [exp]	73.5	0.4508
					Lus10016118 [exp]	73.8	0.4451

Compare expression of checked genes

Lus10014354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.