Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25344 40 / 6e-06 LCR14 low-molecular-weight cysteine-rich 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014354 [exp] 124 / 4e-39 AT2G25344 49 / 3e-09 low-molecular-weight cysteine-rich 14 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF07333 [flax] [poplar] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Lus10014355 pacid=23164748 polypeptide=Lus10014355 locus=Lus10014355.g ID=Lus10014355.BGIv1.0 annot-version=v1.0 ATGGCTTCTGCTTTCGCGATCGTTCTCTTGCTTCTTACCACGGTCATCATTCATGGTGTTGCAAGTGGAGTTGTTGGAGTGGATGCAAAAAGATGCATCG CTGTGTTGTATGAAGGAGCCTGTGAAGAGGACCAATGCACTAGTGATTGTATTACAAAGCATGGCAAGAAATCCGTTGGGTTTTGCGGTACCGGTGATGG TGTTTGTACTTGCGATTACGATTGTTAA
AA sequence Show only first row Show all	>Lus10014355 pacid=23164748 polypeptide=Lus10014355 locus=Lus10014355.g ID=Lus10014355.BGIv1.0 annot-version=v1.0 MASAFAIVLLLLTTVIIHGVASGVVGVDAKRCIAVLYEGACEEDQCTSDCITKHGKKSVGFCGTGDGVCTCDYDC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25344		LCR14	low-molecular-weight cysteine-...		Lus10014355 [exp]	0	1
AT1G13570			F-box/RNI-like superfamily pro...		Lus10020638 [exp]	1.7	0.8123
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Lus10008843 [exp]	3.5	0.8078
					Lus10017627 [exp]	4.1	0.8496
AT1G61105			Toll-Interleukin-Resistance (T...		Lus10011216 [exp]	6.2	0.8140
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10010873 [exp]	10.5	0.8039
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	13.6	0.7483
AT5G04885			Glycosyl hydrolase family prot...		Lus10008434 [exp]	14.7	0.6926
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	14.7	0.7483
					Lus10039432 [exp]	15.7	0.7483
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	16.7	0.7483

Compare expression of checked genes

Lus10014355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.