Lus10014362 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48540 39 / 0.0005 receptor-like protein kinase-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018233 58 / 3e-11 ND /
Lus10040672 57 / 5e-11 ND /
Lus10018232 51 / 1e-08 ND /
Lus10040673 49 / 8e-08 ND 36 / 0.007
Lus10040671 47 / 2e-07 ND /
Lus10003724 45 / 2e-06 AT1G70530 45 / 7e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10008656 44 / 5e-06 AT4G05200 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10028019 41 / 4e-05 AT1G70530 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10028026 40 / 7e-05 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G029500 44 / 8e-06 AT5G48540 0 / 1 receptor-like protein kinase-related family protein (.1)
Potri.011G030500 43 / 2e-05 AT5G48540 109 / 4e-28 receptor-like protein kinase-related family protein (.1)
Potri.005G208400 41 / 4e-05 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.011G030800 40 / 0.0001 AT3G22060 105 / 5e-27 Receptor-like protein kinase-related family protein (.1)
Potri.004G024404 40 / 0.0003 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028700 39 / 0.0004 AT4G21410 460 / 4e-152 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10014362 pacid=23164649 polypeptide=Lus10014362 locus=Lus10014362.g ID=Lus10014362.BGIv1.0 annot-version=v1.0
ATGTCAGTCGTCCTGTTTTCAACTTTCTACCTCTCCGGGAGCTTAGTGCTACTAGTTTCTGCTTATTCCGCCGGCGACTTGAACGGATATTGCAACCACG
TCAAGTCCAAGGACGGTTCCAATCCTTTTGTGACTGCTTCCATAGAGTTGTTGGCCACATTGGCCAGCGAGATGCCTAACAAGCCCGAGTTCTACTTATG
CACCGATCAAACTTTCGGAATTTGCACCCATCATGGCGAAGCCGGATGCATTATCACTGCTAGTGTCAAGGATTGCGCCAACTGTCTCGTGGTCGCTAAG
GATTACCTGCTGACGACTTGCAATAACATGATCGGCGGTAGGACCTGGGAGAGCAGTAATCGTTGTTACATGAGGTATGAGAACTATAGGAACGTCTGCA
CCCCTAAGTAG
AA sequence
>Lus10014362 pacid=23164649 polypeptide=Lus10014362 locus=Lus10014362.g ID=Lus10014362.BGIv1.0 annot-version=v1.0
MSVVLFSTFYLSGSLVLLVSAYSAGDLNGYCNHVKSKDGSNPFVTASIELLATLASEMPNKPEFYLCTDQTFGICTHHGEAGCIITASVKDCANCLVVAK
DYLLTTCNNMIGGRTWESSNRCYMRYENYRNVCTPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48540 receptor-like protein kinase-r... Lus10014362 0 1
Lus10019580 1.0 0.8172
AT5G52975 Protein of unknown function (D... Lus10032886 13.4 0.6860
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10024900 13.7 0.6997
AT5G43120 ARM-repeat/Tetratricopeptide r... Lus10018706 17.1 0.6478
AT5G04390 C2H2ZnF C2H2-type zinc finger family p... Lus10040425 17.5 0.6364
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 19.6 0.6968
Lus10010418 21.6 0.6635
AT5G47950 HXXXD-type acyl-transferase fa... Lus10034019 22.9 0.6831
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10023810 28.0 0.6436
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10000880 35.3 0.6446

Lus10014362 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.