Plant FIBer expression Database

Lus10014385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21110 272 / 2e-95 G10 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023881
[exp]
298 / 7e-106 AT4G21110 271 / 3e-95 G10 family protein (.1)
Lus10035562
[exp]
289 / 2e-102 AT4G21110 273 / 5e-96 G10 family protein (.1)
Lus10027728
[exp]
295 / 6e-97 AT3G10050 787 / 0.0 L-O-methylthreonine resistant 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G147000
[exp]
274 / 2e-96 AT4G21110 244 / 1e-84 G10 family protein (.1)
Potri.004G186600
[exp]
269 / 2e-94 AT4G21110 239 / 1e-82 G10 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01125 G10 G10 protein
Representative CDS sequence
>Lus10014385 pacid=23143680 polypeptide=Lus10014385 locus=Lus10014385.g ID=Lus10014385.BGIv1.0 annot-version=v1.0
ATGCCAAAGGTGAAGACGAATCGCGTCAAGTACCCGGAGGGCTGGGAGTTAATCGAGCCAACTCTTCGTGAACTGCAGGGAAAGATGAGAGAAGCTGAGA
ATGAGTCACATGATGGTAAGAGGAAATGTGAGGCACTGTGGCCAATTTTCAAGATAGCACATCAGAAGAGCCGCTATATTTTCGACCTTTACCATCGCAG
GAAGGAAATATCCAAGGAATTGTATGAGTTCTGCATGGATCAAGGTTACGCAGACCGTAATCTCATTGCAAAGTGGAAGAAGCCTGGGTACGAGCGGTTA
TGCTGCTTAAGATGCATCCAACCAAGGGACCATAACTTTGCCACTACGTGTGTTTGTCGAGTGCCGAAGAACATCCGAGAGGAAGAGGTGATAGAATGCG
TGCATTGCGGGTGTAAAGGCTGTGCAAGTGGAGATTGA
AA sequence
>Lus10014385 pacid=23143680 polypeptide=Lus10014385 locus=Lus10014385.g ID=Lus10014385.BGIv1.0 annot-version=v1.0
MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENESHDGKRKCEALWPIFKIAHQKSRYIFDLYHRRKEISKELYEFCMDQGYADRNLIAKWKKPGYERL
CCLRCIQPRDHNFATTCVCRVPKNIREEEVIECVHCGCKGCASGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21110 G10 family protein (.1) Lus10014385
[exp]
0 1
AT3G07590 Small nuclear ribonucleoprotei... Lus10016068
[exp]
4.0 0.8698
AT3G16080 Zinc-binding ribosomal protein... Lus10011446
[exp]
5.5 0.8808
AT1G51060 HTA10 histone H2A 10 (.1) Lus10032464
[exp]
6.2 0.8862
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Lus10009963
[exp]
6.5 0.8598
AT2G47580 U1A spliceosomal protein U1A (.1) Lus10003358
[exp]
7.1 0.8656
AT3G53730 Histone superfamily protein (.... Lus10005898
[exp]
7.5 0.8754
AT5G57120 unknown protein Lus10001627
[exp]
8.5 0.8545
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10004366
[exp]
9.5 0.8637
AT5G24840 tRNA (guanine-N-7) methyltrans... Lus10026965
[exp]
9.9 0.8092
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10037655
[exp]
14.1 0.8558

Lus10014385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.